Copy Link Print Information

ASGR1/ASGPR1 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for ASGR1/ASGPR1 Protein, Mouse (HEK293, His)
  • ASGR1/ASGPR1 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Background

ASGR1/ASGPR1 Protein assumes a crucial role in cellular processes by mediating the endocytosis of plasma glycoproteins whose terminal sialic acid residue on complex carbohydrate moieties has been removed. The receptor's recognition of terminal galactose and N-acetylgalactosamine units enables the internalization of ligands, forming a complex that is subsequently transported to a sorting organelle. Within this organelle, the receptor and ligand disassociate, and ASGR1/ASGPR1 is recycled back to the cell membrane surface. The protein's involvement in these dynamic processes underscores its significance in the cellular handling of glycoproteins and contributes to the regulation of cellular homeostasis. Notably, ASGR1/ASGPR1 also interacts with LASS2, expanding its molecular associations and suggesting potential implications in cellular signaling or coordination.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized ASGR1 at 2.5 μg/mL (100 μL/well) can bind Biotinylated Von Willebrand Factor. The ED50 for this effect is 0.8278 μg/mL, corresponding to a specific activity is 1.21×103 Unit/mg.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized ASGR1 at 2.5 μg/mL (100 μL/well) can bind Biotinylated Von Willebrand Factor. The ED50 for this effect is 0.8278 μg/mL, corresponding to a specific activity is 1.21×103 Unit/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-His
  • Accession

    P34927 (S60-N284)

  • Gene ID
    11889  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • ASGR1 (S60-N284)
      Accession # P34927
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ASGR1; ASGR1 Protein; Asialoglycoprotein Receptor 1; ASGP-R 1; CLEC4H1; ASGPR 1; C-Type Lectin Domain Family 4 Member H1; ASGPR1; Hepatic Lectin H1; ASGPR; HL-1

  • AA Sequence

    SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

  • Molecular Weight

    Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized ASGR1 at 2.5 μg/mL (100 μL/well) can bind Biotinylated Von Willebrand Factor. The ED50 for this effect is 0.8278 μg/mL, corresponding to a specific activity is 1.21×103 Unit/mg.

  • ASGR1/ASGPR1 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for ASGR1/ASGPR1 Protein, Mouse (HEK293, His)
  • ASGR1/ASGPR1 Protein, Mouse (HEK293, His) Product Image