2. Protéines recombinantes
  3. Enzymes & Regulators Ubiquitin Related Proteins
  4. Transferases (EC 2) Ubiquitin Enzymes
  5. E2 Enzymes
  6. Autophagy-Related Protein 10 (ATG10)
  7. ATG10 Protein, Human (GST)

ATG10 Protein, Human (GST) is a recombinant human Autophagy Related 10 Homolog (ATG10) expressed in E. coli with a GST tag. ATG10 is an E2 ubiquitin-conjugating-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Obtenir un devis  
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

ATG10 Protein, Human (GST) is a recombinant human Autophagy Related 10 Homolog (ATG10) expressed in E. coli with a GST tag. ATG10 is an E2 ubiquitin-conjugating-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation[1].
Background

Autophagy-related 10 (ATG10) is essential for autophagy since it promotes ATG5-ATG12 complex formation. Autophagy-related 10 gene (ATG10), which encodes an E2-like enzyme, interacts with ATG7 to receive an ubiquitin-like protein ATG12, recognizes both ATG12 and ATG5 directly and catalyzes their conjugation reaction. ATG10 plays an important role in the invasion and proliferation of cancer cells, and bacterial infections[1].
Species

Human
Source

E. coli
Tag

N-GST
Accession

Q9H0Y0 (M1-P220)
Gene ID

83734
Protein Length

Full Length
Synonyms
Ubiquitin-Like-Conjugating Enzyme ATG10; Autophagy-Related Protein 10; APG10-Like; ATG10
AA Sequence

MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Predicted Molecular Mass
52.3 kDa
Pureté

≥ 90%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Instruction de manipulation (2659 KB)

ATG10 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

ATG10 Protein, Human (GST)

  

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

      

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
ATG10 Protein, Human (GST)
Cat. No.:
HY-P701246
Quantité:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nom du produit

  

Lot #

Nom du demandeur *

 

Country or Region *

Adresse e-mail *

     

Numéro de téléphone *

 

Nom de l'organisation *

Remarques

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.