ATG10 Protein, Human (GST)
ATG10 Protein, Human (GST) is a recombinant human Autophagy Related 10 Homolog (ATG10) expressed in E. coli with a GST tag. ATG10 is an E2 ubiquitin-conjugating-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ATG10 Protein, Human (GST) is a recombinant human Autophagy Related 10 Homolog (ATG10) expressed in E. coli with a GST tag. ATG10 is an E2 ubiquitin-conjugating-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation[1].
Background
Autophagy-related 10 (ATG10) is essential for autophagy since it promotes ATG5-ATG12 complex formation. Autophagy-related 10 gene (ATG10), which encodes an E2-like enzyme, interacts with ATG7 to receive an ubiquitin-like protein ATG12, recognizes both ATG12 and ATG5 directly and catalyzes their conjugation reaction. ATG10 plays an important role in the invasion and proliferation of cancer cells, and bacterial infections[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9H0Y0 (M1-P220)
-
Gene ID83734
-
Protein Length
Full Length
-
Synonyms
ATG10; ATG10 Autophagy Related 10 Homolog (S. Cerevisiae); Prev. APG10L; ATG10 Autophagy Related 10 Homolog; Ubiquitin-Like-Conjugating Enzyme ATG10; APG10 Autophagy 10-Like; Autophagy-Related Protein 10; APG10-Like; DKFZP586I0418; Pp12616; FLJ13954; APG1
-
AA Sequence
MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
-
Predicted Molecular Mass
52.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
