ATG101 Protein, Human (sf9, His, Strep)
ATG101 Protein, Human (sf9, His, Strep) is the recombinant human-derived ATG101, expressed by sf9 insect cells, with Strep, His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ATG101 Protein, Human (sf9, His, Strep) is the recombinant human-derived ATG101, expressed by sf9 insect cells, with Strep, His labeled tag.
Background
ATG101 is an autophagy factor required for autophagosome formation. It stabilizes ATG13, protecting it from proteasomal degradation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Strep;His
-
Accession
Q9BSB4 (M1-D198)
-
Gene ID60673
-
Protein Length
Partial
-
Synonyms
ATG101; FLJ11773; Prev. C12orf44; Atg13-Interacting Protein; Autophagy-Related Protein 101; Autophagy Related 101; Chromosome 12 Open Reading Frame 44
-
AA Sequence
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITD
-
Predicted Molecular Mass
26.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
