ATP6V0D1 Protein, Human (GST)

ATP6V0D1 Protein, Human (GST) is the recombinant human-derived ATP6V0D1, expressed by E. coli, with N-GST labeled tag.

ATP6V0D1 is a subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme consisting of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and, in some cell types, is targeted to the plasma membrane, where it acidifies the extracellular environment. ATP6V0D1 may play a role in coupling proton transport with ATP hydrolysis (By similarity). Under aerobic conditions, it is involved in intracellular iron homeostasis, triggering the activity of Fe²⁺ prolyl hydroxylase (PHD) enzymes, leading to HIF1A hydroxylation and subsequent proteasomal degradation. Additionally, it may regulate the transport and localization of proteins to the cilium, contributing to cilium biogenesis (By similarity).

Human

E. coli

N-GST

P61421 (M1-F351)

9114

Full Length

MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

Approximately 63 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.