ATP6V0D1 Protein, Human (GST)
Based on 1 Customer Validation
ATP6V0D1 Protein, Human (GST) is the recombinant human-derived ATP6V0D1, expressed by E. coli, with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ATP6V0D1 Protein, Human (GST) is the recombinant human-derived ATP6V0D1, expressed by E. coli, with N-GST labeled tag.
Background
ATP6V0D1 is a subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme consisting of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and, in some cell types, is targeted to the plasma membrane, where it acidifies the extracellular environment. ATP6V0D1 may play a role in coupling proton transport with ATP hydrolysis (By similarity). Under aerobic conditions, it is involved in intracellular iron homeostasis, triggering the activity of Fe2+ prolyl hydroxylase (PHD) enzymes, leading to HIF1A hydroxylation and subsequent proteasomal degradation. Additionally, it may regulate the transport and localization of proteins to the cilium, contributing to cilium biogenesis (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P61421 (M1-F351)
-
Gene ID9114
-
Protein Length
Full Length
-
Synonyms
ATP6V0D1; V-Type Proton ATPase Subunit D 1; Prev. ATP6D; 32 KDa Accessory Protein; VPATPD; V-ATPase AC39 Subunit; P39; V-ATPase Subunit D 1; ATP6DV; ATPase, H+ Transporting, Lysosomal 38kDa, V0 Subunit D Isoform 1; VATX; H(+)-Transporting Two-Sector ATPas
-
AA Sequence
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
-
Predicted Molecular Mass
67.3 kDa
-
Molecular Weight
Approximately 63 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
