Azide-labeled B7-H4 Protein, Mouse (HEK293, His)
The B7-H4 protein acts as a negative regulator and inhibits T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. Significant significance can be observed when expressed on tumor macrophages, cooperating with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity. Azide-labeled B7-H4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Azide-labeled B7-H4 protein, expressed by HEK293, with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The B7-H4 protein acts as a negative regulator and inhibits T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. Significant significance can be observed when expressed on tumor macrophages, cooperating with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity. Azide-labeled B7-H4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Azide-labeled B7-H4 protein, expressed by HEK293, with C-His labeled tag.
Background
B7-H4 protein serves as a negative regulator of the T-cell-mediated immune response by suppressing T-cell activation, proliferation, cytokine production, and the development of cytotoxicity. Its significance is particularly pronounced when expressed on the cell surface of tumor macrophages, where it collaborates with regulatory T-cells (Treg) to play a crucial role in suppressing tumor-associated antigen-specific T-cell immunity. Beyond its immunomodulatory functions, B7-H4 is also implicated in promoting epithelial cell transformation, highlighting its involvement in diverse cellular processes associated with immune regulation and tumorigenesis.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q7TSP5-1 (L25-G257)
-
Gene ID242122
-
Molecular Construction
-
N-term
-
B7-H4 (L25-G257)
Accession # Q7TSP5-1 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
VTCN1; V-Set Domain Containing T Cell Activation Inhibitor 1; B7-H4; B7H4; B7h.5; B7S1; B7x; V-Set Domain-Containing T-Cell Activation Inhibitor 1; Immune Costimulatory Protein B7-H4; B7 Superfamily Member 1; B7 Family Member, H4; B7 Homolog 4; FLJ22418;
-
AA Sequence
LIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSG
-
Predicted Molecular Mass
40.3 kDa
-
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
