1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. B7-H2/ICOSLG B7-H2/CD275
  5. Azide-labeled B7-H4 Protein, Mouse (HEK293, His)

Azide-labeled B7-H4 Protein, Mouse (HEK293, His)

Cat. No.: HY-P704416
Handling Instructions Technical Support

The B7-H4 protein acts as a negative regulator and inhibits T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. Significant significance can be observed when expressed on tumor macrophages, cooperating with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity. Azide-labeled B7-H4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Azide-labeled B7-H4 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The B7-H4 protein acts as a negative regulator and inhibits T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. Significant significance can be observed when expressed on tumor macrophages, cooperating with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity. Azide-labeled B7-H4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Azide-labeled B7-H4 protein, expressed by HEK293, with C-His labeled tag.

Background

B7-H4 protein serves as a negative regulator of the T-cell-mediated immune response by suppressing T-cell activation, proliferation, cytokine production, and the development of cytotoxicity. Its significance is particularly pronounced when expressed on the cell surface of tumor macrophages, where it collaborates with regulatory T-cells (Treg) to play a crucial role in suppressing tumor-associated antigen-specific T-cell immunity. Beyond its immunomodulatory functions, B7-H4 is also implicated in promoting epithelial cell transformation, highlighting its involvement in diverse cellular processes associated with immune regulation and tumorigenesis.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q7TSP5-1 (L25-G257)

Gene ID

242122

Molecular Construction
N-term
B7-H4 (L25-G257)
Accession # Q7TSP5-1
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
V-set domain containing T-cell activation inhibitor 1; VTCN1; Protein B7S1; B7-H4
AA Sequence

LIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSG

Predicted Molecular Mass
40.3 kDa
Molecular Weight

Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Azide-labeled B7-H4 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Azide-labeled B7-H4 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P704416
Quantity:
MCE Japan Authorized Agent: