FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His)
The FCGRT protein delivers passive immunity by binding to monomeric IgG and promoting its absorption from milk. It forms an FcRn-IgG complex, which is transcytosis by the intestinal epithelium and releases IgG into the bloodstream or interstitial fluid. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His) is a recombinant protein dimer complex containing cynomolgus-derived FCGRT-B2M Heterodimer protein, expressed by HEK293 , with C-Flag, C-6*His labeled tag. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His), has molecular weight of 33 & 14 kDa, respectively.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FCGRT protein delivers passive immunity by binding to monomeric IgG and promoting its absorption from milk. It forms an FcRn-IgG complex, which is transcytosis by the intestinal epithelium and releases IgG into the bloodstream or interstitial fluid. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His) is a recombinant protein dimer complex containing cynomolgus-derived FCGRT-B2M Heterodimer protein, expressed by HEK293 , with C-Flag, C-6*His labeled tag. FCGRT-B2M Heterodimer Protein, Cynomolgus (HEK293, Flag-His), has molecular weight of 33 & 14 kDa, respectively.
Background
The FCGRT protein is a cell surface receptor that plays a critical role in transferring passive humoral immunity from the mother to the newborn. It accomplishes this by binding to the Fc region of monomeric immunoglobulin gamma and facilitating its selective uptake from milk. Within the intestinal epithelium, the FCGRT-B2M heterodimer binds to IgG at the apical surface, forming FcRn-IgG complexes that are transcytosed across the epithelium, releasing IgG into the bloodstream or tissue fluids. This receptor continues to contribute to effective humoral immunity throughout life by recycling IgG and prolonging its half-life in circulation. Mechanistically, the binding of monomeric IgG to FCGRT-B2M in acidic endosomes of endothelial and hematopoietic cells enables the recycling of IgG to the cell surface for release into the circulation. Additionally, the FCGRT-B2M heterodimer plays a role in regulating the homeostasis of albumin, the most abundant circulating protein, by interacting with it. The FCGRT-B2M complex consists of two subunits, p51 and p14 (equivalent to beta-2-microglobulin), forming an MHC class I-like heterodimer.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-Flag;C-6*His
-
Accession
Q8SPV9 (A24-S297)&Q8SPW0 (I21-M119)
-
Molecular Construction
-
N-term
-
B2M (I21-M119)
Accession # Q8SPW0 -
C-term
-
N-term
-
FCGRT (A24-S297)
Accession # Q8SPV9-1 -
Flag-6*His
-
C-term
-
-
Synonyms
FCGRT; Major Histocompatibility Complex Class I-Like Fc Receptor; Fc Gamma Receptor And Transporter; Neonatal Crystallizable Fc Receptor FcRn Splice Variant 6; Neonatal Fc Receptor; Neonatal Crystallizable Fc Receptor FcRn Splice Variant 5; FcRn; Neonatal
-
AA Sequence
IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM&AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSS
-
Predicted Molecular Mass
12.6 kDa & 31.3 kDa
-
Molecular Weight
Approximately 14 kDa & 33 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
