B7-1/CD80 Protein, Macaca nemestrina (HEK293, hFc)
B7-1/CD80 Protein is pivotal in providing the costimulatory signal crucial for T lymphocyte activation. T-cell proliferation and cytokine production hinge on the binding of CD28 or CTLA-4 to this receptor. As a crucial immune response mediator, B7-1/CD80 facilitates dynamic interplay between T cells and regulatory receptors, influencing essential processes for T lymphocyte activation and regulation in the immune system. B7-1/CD80 Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
B7-1/CD80 Protein is pivotal in providing the costimulatory signal crucial for T lymphocyte activation. T-cell proliferation and cytokine production hinge on the binding of CD28 or CTLA-4 to this receptor. As a crucial immune response mediator, B7-1/CD80 facilitates dynamic interplay between T cells and regulatory receptors, influencing essential processes for T lymphocyte activation and regulation in the immune system. B7-1/CD80 Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The B7-1/CD80 Protein plays a pivotal role in the costimulatory signal necessary for the activation of T lymphocytes. The induction of T-cell proliferation and cytokine production is contingent upon the binding of CD28 or CTLA-4 to this receptor. As a crucial mediator of immune responses, B7-1/CD80 facilitates the dynamic interplay between T cells and their regulatory receptors, thereby influencing key processes essential for the activation and regulation of T lymphocytes in the immune system.
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-hFc
-
Accession
O77684/AAC31555 (V35-N242)
-
Gene ID/
-
Molecular Construction
-
N-term
-
B7-1 (V35-N242)
Accession # O77684/AAC31555 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD80; B-Lymphocyte Activation Antigen B7; Prev. CD28LG1; LAB7; Prev. CD28LG; BB1; T-Lymphocyte Activation Antigen CD80; B7; Activation B7-1 Antigen; Costimulatory Molecule Variant IgV-CD80; B7.1; Costimulatory Factor CD80; B7-1; CD80 Molecule; CD80 Antige
-
AA Sequence
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDN
-
Predicted Molecular Mass
50.9 kDa
-
Molecular Weight
Approximately 65 kDa & 44 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
