B7-1/CD80 Protein, Mouse (Biotinylated, HEK293, His)
B7-1/CD80 Protein, crucial in activating T lymphocytes, engages CD28 or CTLA-4 receptors, inducing proliferation and cytokine production. This interaction regulates immune responses and influences T lymphocyte activation and function. Serving as a key checkpoint, B7-1/CD80 orchestrates signaling events, controlling the immune system's dynamic responses. B7-1/CD80 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived B7-1/CD80 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
B7-1/CD80 Protein, crucial in activating T lymphocytes, engages CD28 or CTLA-4 receptors, inducing proliferation and cytokine production. This interaction regulates immune responses and influences T lymphocyte activation and function. Serving as a key checkpoint, B7-1/CD80 orchestrates signaling events, controlling the immune system's dynamic responses. B7-1/CD80 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived B7-1/CD80 protein, expressed by HEK293 , with C-His labeled tag.
Background
B7-1/CD80 Protein plays a pivotal role in the costimulatory signal necessary for the activation of T lymphocytes. Its engagement with CD28 or CTLA-4 receptors is integral to inducing T-cell proliferation and cytokine production. The interaction between B7-1/CD80 and these receptors orchestrates critical signaling events that regulate immune responses, influencing the activation and function of T lymphocytes. This molecular interaction serves as a key checkpoint in the complex network of cellular signals governing the immune system's dynamic responses.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q00609 (V38-K245)
-
Molecular Construction
-
N-term
-
B7-1 (V38-K245)
Accession # Q00609 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CD80; B-Lymphocyte Activation Antigen B7; Prev. CD28LG1; LAB7; Prev. CD28LG; BB1; T-Lymphocyte Activation Antigen CD80; B7; Activation B7-1 Antigen; Costimulatory Molecule Variant IgV-CD80; B7.1; Costimulatory Factor CD80; B7-1; CD80 Molecule; CD80 Antige
-
AA Sequence
VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSK
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
