BAFFR/TNFRSF13C Protein, Human (HEK293, hFc)
BAFFR/TNFRSF13C Protein, a B-cell receptor, specifically recognizes TNFSF13B/TALL1/BAFF/BLyS, playing a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to a healthy immune system. BAFFR/TNFRSF13C Protein, Human (HEK293, hFc) is the recombinant human-derived BAFFR/TNFRSF13C protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BAFFR/TNFRSF13C Protein, a B-cell receptor, specifically recognizes TNFSF13B/TALL1/BAFF/BLyS, playing a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to a healthy immune system. BAFFR/TNFRSF13C Protein, Human (HEK293, hFc) is the recombinant human-derived BAFFR/TNFRSF13C protein, expressed by HEK293, with C-hFc labeled tag.
Background
BAFFR/TNFRSF13C protein is a B-cell receptor that specifically recognizes TNFSF13B/TALL1/BAFF/BLyS. It plays a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to the maintenance of a healthy immune system.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q96RJ3-1 (S7-A71)
-
Gene ID115650
-
Molecular Construction
-
N-term
-
BAFFR (S7-A71)
Accession # Q96RJ3-1 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TNFRSF13C; BLyS Receptor 3; TNF Receptor Superfamily Member 13C; B Cell-Activating Factor Receptor; BAFFR; B-Cell-Activating Factor Receptor; BAFF Receptor; CD268 Antigen; BAFF-R; Prolixin; CD268; BROMIX; Tumor Necrosis Factor Receptor Superfamily, Member
-
AA Sequence
SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
-
Predicted Molecular Mass
33.1 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
