1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TNF Superfamily Cytokine Receptors
  4. TNF Receptor Superfamily
  5. BAFF Receptor
  6. BAFFR/TNFRSF13C Protein, Human (HEK293, hFc)

BAFFR/TNFRSF13C Protein, a B-cell receptor, specifically recognizes TNFSF13B/TALL1/BAFF/BLyS, playing a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to a healthy immune system. BAFFR/TNFRSF13C Protein, Human (HEK293, hFc) is the recombinant human-derived BAFFR/TNFRSF13C protein, expressed by HEK293, with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
100 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

BAFFR/TNFRSF13C Protein, a B-cell receptor, specifically recognizes TNFSF13B/TALL1/BAFF/BLyS, playing a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to a healthy immune system. BAFFR/TNFRSF13C Protein, Human (HEK293, hFc) is the recombinant human-derived BAFFR/TNFRSF13C protein, expressed by HEK293, with C-hFc labeled tag.

Background

BAFFR/TNFRSF13C protein is a B-cell receptor that specifically recognizes TNFSF13B/TALL1/BAFF/BLyS. It plays a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to the maintenance of a healthy immune system.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human BAFF, His Tag at 5 μg/mL (100 μL/well) can bind Human BAFFR Protein, Fc Tag with the EC50 of 0.001647 μg/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q96RJ3-1 (S7-A71)

Gene ID

115650

Molecular Construction
N-term
BAFFR (S7-A71)
Accession # Q96RJ3-1
hFc
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member 13C; BAFF-R; CD268; TNFRSF13C; BR3
AA Sequence

SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA

Predicted Molecular Mass
33.1 kDa
분자량

Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

BAFFR/TNFRSF13C Protein, Human (HEK293, hFc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
BAFFR/TNFRSF13C Protein, Human (HEK293, hFc)
Cat. No.:
HY-P704248
수량:
MCE Japan Authorized Agent: