1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. BBOX1 Protein, Human (sf9, His-GST)

The BBOX1 protein plays a central role in cellular processes as it catalyzes the formation of L-carnitine from gamma-butybetaine. This enzyme activity is essential for the biosynthesis of L-carnitine, an important compound involved in fatty acid metabolism and energy production. BBOX1 Protein, Human (sf9, His-GST) is the recombinant human-derived BBOX1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BBOX1 protein plays a central role in cellular processes as it catalyzes the formation of L-carnitine from gamma-butybetaine. This enzyme activity is essential for the biosynthesis of L-carnitine, an important compound involved in fatty acid metabolism and energy production. BBOX1 Protein, Human (sf9, His-GST) is the recombinant human-derived BBOX1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

BBOX1 (gamma-butyrobetaine dioxygenase 1) is an enzyme that catalyzes the formation of L-carnitine from gamma-butyrobetaine. This enzymatic process is a key step in the biosynthesis of L-carnitine, an essential compound involved in the transport of fatty acids into mitochondria for beta-oxidation. By converting gamma-butyrobetaine into L-carnitine, BBOX1 contributes to the regulation of carnitine levels, which play a crucial role in energy metabolism. L-carnitine serves as a cofactor in the transport of long-chain fatty acids across the mitochondrial membrane, facilitating their utilization as a source of energy. It has to succinctly outline BBOX1's specific role in the biosynthesis of L-carnitine, emphasizing its importance in cellular metabolism and energy homeostasis.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

O75936 (M1-N387)

Gene ID
Molecular Construction
N-term
His-GST
BBOX1 (M1-N387)
Accession # O75936
C-term
Protein Length

Full Length

Synonyms
Gamma-butyrobetaine dioxygenase; Gamma-BBH; BBH; BBOX
AA Sequence

MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN

Molecular Weight

Approximately 65 kDa.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

BBOX1 Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BBOX1 Protein, Human (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BBOX1 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P76163
Quantity:
MCE Japan Authorized Agent: