BBOX1 Protein, Human (sf9, His-GST)

The BBOX1 protein plays a central role in cellular processes as it catalyzes the formation of L-carnitine from gamma-butybetaine. This enzyme activity is essential for the biosynthesis of L-carnitine, an important compound involved in fatty acid metabolism and energy production. BBOX1 Protein, Human (sf9, His-GST) is the recombinant human-derived BBOX1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

BBOX1 (gamma-butyrobetaine dioxygenase 1) is an enzyme that catalyzes the formation of L-carnitine from gamma-butyrobetaine. This enzymatic process is a key step in the biosynthesis of L-carnitine, an essential compound involved in the transport of fatty acids into mitochondria for beta-oxidation. By converting gamma-butyrobetaine into L-carnitine, BBOX1 contributes to the regulation of carnitine levels, which play a crucial role in energy metabolism. L-carnitine serves as a cofactor in the transport of long-chain fatty acids across the mitochondrial membrane, facilitating their utilization as a source of energy. It has to succinctly outline BBOX1's specific role in the biosynthesis of L-carnitine, emphasizing its importance in cellular metabolism and energy homeostasis.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

Sf9 insect cells

N-His;N-GST

O75936 (M1-N387)

8424  [NCBI]

Full Length

MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN

Approximately 65 kDa.

≥ 85%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.