BBOX1 Protein, Human (sf9, His-GST)

Customer Review

Based on 1 Customer Validation

The BBOX1 protein plays a central role in cellular processes as it catalyzes the formation of L-carnitine from gamma-butybetaine. This enzyme activity is essential for the biosynthesis of L-carnitine, an important compound involved in fatty acid metabolism and energy production. BBOX1 Protein, Human (sf9, His-GST) is the recombinant human-derived BBOX1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The BBOX1 protein plays a central role in cellular processes as it catalyzes the formation of L-carnitine from gamma-butybetaine. This enzyme activity is essential for the biosynthesis of L-carnitine, an important compound involved in fatty acid metabolism and energy production. BBOX1 Protein, Human (sf9, His-GST) is the recombinant human-derived BBOX1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

BBOX1 (gamma-butyrobetaine dioxygenase 1) is an enzyme that catalyzes the formation of L-carnitine from gamma-butyrobetaine. This enzymatic process is a key step in the biosynthesis of L-carnitine, an essential compound involved in the transport of fatty acids into mitochondria for beta-oxidation. By converting gamma-butyrobetaine into L-carnitine, BBOX1 contributes to the regulation of carnitine levels, which play a crucial role in energy metabolism. L-carnitine serves as a cofactor in the transport of long-chain fatty acids across the mitochondrial membrane, facilitating their utilization as a source of energy. It has to succinctly outline BBOX1's specific role in the biosynthesis of L-carnitine, emphasizing its importance in cellular metabolism and energy homeostasis.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • BBOX1 (M1-N387)
      Accession # O75936
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    BBOX1; Butyrobetaine (Gamma), 2-Oxoglutarate Dioxygenase (Gamma-Butyrobetaine Hydroxylase) 1; Prev. BBOX; Gamma-Butyrobetaine Hydroxylase; Gamma-BBH; Gamma-Butyrobetaine,2-Oxoglutarate Dioxygenase 1; BBH; Gamma-Butyrobetaine,2-Oxoglutarate Dioxygenase; G-

  • AA Sequence

    MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN

  • Predicted Molecular Mass

    72.5 kDa

  • Molecular Weight

    Approximately 65 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00