Beta-NGF Protein, Mouse (HEK293)
Based on 1 Customer Validation
Beta-NGF protein is essential for the development and maintenance of the nervous system and binds to NTRK1 and NGFR receptors to initiate signaling cascades that regulate neuronal processes. The NGF precursor proNGF acts as a ligand for the SORCS2-NGFR receptor and activates pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. Beta-NGF Protein, Mouse (HEK293) is the recombinant mouse-derived Beta-NGF protein, expressed by HEK293, with tag free.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Beta-NGF protein is essential for the development and maintenance of the nervous system and binds to NTRK1 and NGFR receptors to initiate signaling cascades that regulate neuronal processes. The NGF precursor proNGF acts as a ligand for the SORCS2-NGFR receptor and activates pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. Beta-NGF Protein, Mouse (HEK293) is the recombinant mouse-derived Beta-NGF protein, expressed by HEK293, with tag free.
Background
Beta-NGF, a pivotal factor in the development and maintenance of the sympathetic and sensory nervous systems, acts as an extracellular ligand for the NTRK1 and NGFR receptors, triggering cellular signaling cascades that regulate neuronal proliferation, differentiation, and survival. The immature NGF precursor (proNGF) serves as a ligand for the heterodimeric receptor formed by SORCS2 and NGFR, inducing signaling cascades that result in the inactivation of RAC1 and/or RAC2, along with the reorganization of the actin cytoskeleton and subsequent neuronal growth cone collapse. In contrast to mature NGF, proNGF has been identified to promote neuronal apoptosis in vitro. Additionally, Beta-NGF inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binding to lysophosphatidylinositol and lysophosphatidylserine within its homodimeric structure, Beta-NGF exhibits diverse functions in cellular responses, including promoting histamine release from mast cells when in its lipid-bound form. The homodimeric structure of Beta-NGF interacts with NTRK1, NGFR, and SORCS2, while the NGF precursor (proNGF) binds to a receptor complex formed by SORT1 and NGFR, leading to NGF endocytosis. These intricate interactions underscore the multifaceted roles of Beta-NGF in orchestrating neuronal functions and cellular responses.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Beta-NGF Protein, Tag Free at 1 μg/mL (100 μL/well) can bind Human TrkA (33-417), Fc Tag with a linear range of 0.2-16 ng/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
P01139 (S122-G241)
-
Gene ID18049
-
Molecular Construction
-
N-term
-
Beta-NGF (S122-G241)
Accession # P01139 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NGF; Beta-NGF; Prev. NGFB; Pro-Nerve Growth Factor Long; Beta-Nerve Growth Factor; HSAN5; Nerve Growth Factor (Beta Polypeptide); Nerve Growth Factor; Nerve Growth Factor, Beta Subunit
-
AA Sequence
SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
-
Predicted Molecular Mass
13.5 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22 μm filtered solution in 20 mM NaAC, 150 mM NaCl, pH5.5 with 10% trehalose as protectant.
<0.1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)