1. Recombinant Proteins
  2. Others
  3. BLNK Protein, Human (HEK293, His)

BLNK proteins function as central linkers downstream of the B cell receptor (BCR), bridging SYK kinases to various signaling pathways and regulating B cell function and development. It activates ERK/EPHB2, MAP kinase p38 and JNK, regulates AP1 activation, and plays a key role in NF-kappa-B and NFAT activation. BLNK Protein, Human (HEK293, His) is the recombinant human-derived BLNK protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BLNK proteins function as central linkers downstream of the B cell receptor (BCR), bridging SYK kinases to various signaling pathways and regulating B cell function and development. It activates ERK/EPHB2, MAP kinase p38 and JNK, regulates AP1 activation, and plays a key role in NF-kappa-B and NFAT activation. BLNK Protein, Human (HEK293, His) is the recombinant human-derived BLNK protein, expressed by HEK293 , with N-His labeled tag.

Background

BLNK, a central linker protein, operates downstream of the B-cell receptor (BCR), serving as a crucial bridge that connects the SYK kinase to various signaling pathways and regulates diverse biological outcomes in B-cell function and development. Its functional spectrum includes playing a role in the activation of ERK/EPHB2, MAP kinase p38, and JNK, as well as modulating AP1 activation. BLNK is pivotal for the activation of NF-kappa-B and NFAT, contributing significantly to BCR-mediated PLCG1 and PLCG2 activation, Ca(2+) mobilization, and the trafficking of the BCR to late endosomes. Notably, BLNK is dispensable for pre-BCR-mediated activation of MAP kinase and phosphatidyl-inositol 3 (PI3) kinase signaling. Additionally, it may be crucial for the RAC1-JNK pathway and plays a critical role in orchestrating the pro-B cell to pre-B cell transition. BLNK's involvement extends to potential participation in BCR-induced B-cell apoptosis, forming essential associations with PLCG1, VAV1, NCK1, VAV3, PLCG2, GRB2, CD79A, and phosphorylated and activated SYK, thereby intricately connecting with key elements in B-cell signaling pathways.

Species

Human

Source

HEK293

Tag

N-His

Accession

Q8WV28-1 (M1-S456)

Gene ID
Molecular Construction
N-term
His
BLNK (M1-S456)
Accession # Q8WV28-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
B-cell linker protein; SLP-65; BLNK; BASH; SLP65
AA Sequence

MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS

Predicted Molecular Mass
53 kDa
Molecular Weight

Approximately 95-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BLNK Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BLNK Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BLNK Protein, Human (HEK293, His)
Cat. No.:
HY-P75474
Quantity:
MCE Japan Authorized Agent: