BLNK Protein, Human (HEK293, His)
BLNK proteins function as central linkers downstream of the B cell receptor (BCR), bridging SYK kinases to various signaling pathways and regulating B cell function and development. It activates ERK/EPHB2, MAP kinase p38 and JNK, regulates AP1 activation, and plays a key role in NF-kappa-B and NFAT activation. BLNK Protein, Human (HEK293, His) is the recombinant human-derived BLNK protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
BLNK proteins function as central linkers downstream of the B cell receptor (BCR), bridging SYK kinases to various signaling pathways and regulating B cell function and development. It activates ERK/EPHB2, MAP kinase p38 and JNK, regulates AP1 activation, and plays a key role in NF-kappa-B and NFAT activation. BLNK Protein, Human (HEK293, His) is the recombinant human-derived BLNK protein, expressed by HEK293 , with N-His labeled tag.
Background
BLNK, a central linker protein, operates downstream of the B-cell receptor (BCR), serving as a crucial bridge that connects the SYK kinase to various signaling pathways and regulates diverse biological outcomes in B-cell function and development. Its functional spectrum includes playing a role in the activation of ERK/EPHB2, MAP kinase p38, and JNK, as well as modulating AP1 activation. BLNK is pivotal for the activation of NF-kappa-B and NFAT, contributing significantly to BCR-mediated PLCG1 and PLCG2 activation, Ca(2+) mobilization, and the trafficking of the BCR to late endosomes. Notably, BLNK is dispensable for pre-BCR-mediated activation of MAP kinase and phosphatidyl-inositol 3 (PI3) kinase signaling. Additionally, it may be crucial for the RAC1-JNK pathway and plays a critical role in orchestrating the pro-B cell to pre-B cell transition. BLNK's involvement extends to potential participation in BCR-induced B-cell apoptosis, forming essential associations with PLCG1, VAV1, NCK1, VAV3, PLCG2, GRB2, CD79A, and phosphorylated and activated SYK, thereby intricately connecting with key elements in B-cell signaling pathways.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q8WV28-1 (M1-S456)
-
Molecular Construction
-
N-term
-
His
-
BLNK (M1-S456)
Accession # Q8WV28-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
BLNK; Bca; B Cell Linker; Src Homology [SH2] Domain-Containing Leukocyte Protein Of 65 KD; SLP65; Src Homology 2 Domain-Containing Leukocyte Protein Of 65 KDa; BASH; B-Cell Adapter Containing A Src Homology 2 Domain Protein; SLP-65; B Cell Adaptor Contain
-
AA Sequence
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS
-
Predicted Molecular Mass
53 kDa
-
Molecular Weight
Approximately 95-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)