BLOC1S2 Protein, Human (N-GST)

Customer Review

Based on 1 Customer Validation

BLOC1S2 is an essential component of the BLOC-1 complex and is critical for the biogenesis of lysosome-related organelles (LROs), including platelet dense granules and melanosomes. BLOC-1 cooperates with the AP-3 complex to direct membrane protein cargo into vesicles for delivery to neurites and nerve terminals, suggesting that it is involved in neurite extension. BLOC1S2 Protein, Human (N-GST) is the recombinant human-derived BLOC1S2 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

BLOC1S2 is an essential component of the BLOC-1 complex and is critical for the biogenesis of lysosome-related organelles (LROs), including platelet dense granules and melanosomes. BLOC-1 cooperates with the AP-3 complex to direct membrane protein cargo into vesicles for delivery to neurites and nerve terminals, suggesting that it is involved in neurite extension. BLOC1S2 Protein, Human (N-GST) is the recombinant human-derived BLOC1S2 protein, expressed by E. coli , with N-GST labeled tag.

Background

BLOC1S2 protein is a vital component of the BLOC-1 complex, crucial for the normal biogenesis of lysosome-related organelles (LRO), including platelet dense granules and melanosomes. Together with the AP-3 complex, the BLOC-1 complex is essential for directing membrane protein cargos into vesicles formed at cell bodies, facilitating their delivery into neurites and nerve terminals. The BLOC-1 complex, in conjunction with SNARE proteins, is also implicated in neurite extension. As a part of the BORC complex, BLOC1S2 may contribute to the movement and localization of lysosomes at the cell periphery, associating with the cytosolic face of lysosomes and potentially recruiting ARL8B to couple lysosomes to microtubule plus-end-directed kinesin motors. Additionally, BLOC1S2 may play a role in cell proliferation as part of the biogenesis of lysosome-related organelles complex 1 (BLOC-1) and the BLOC-one-related complex (BORC), interacting with various components within these complexes, including BLOC1S1, BLOC1S3, BLOC1S4, BLOC1S5, SNAPIN, and IFT57.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • BLOC1S2 (M1-R99)
      Accession # Q6QNY1-2
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    BLOC1S2; CEAP; Biogenesis Of Lysosomal Organelles Complex 1 Subunit 2; Biogenesis Of Lysosome-Related Organelles Complex-1, Subunit 2, Isoform CRA_c; BLOS2; Biogenesis Of Lysosome-Related Organelles Complex-1 Subunit 2; Biogenesis Of Lysosome-Related Orga

  • AA Sequence

    MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR

  • Predicted Molecular Mass

    36.7 kDa

  • Molecular Weight

    Approximately 34 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 10% trehalose, 0.02% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00