BRAF Protein, Human (Flag)

BRAF Protein, Human (Inactive, Flag) is the recombinant human-derived BRAF, expressed by E. coli , with Flag labeled tag.

BRAF is a protein kinase involved in transducing mitogenic signals from the cell membrane to the nucleus (Probable). It phosphorylates MAP2K1, activating the MAP kinase signal transduction pathway (by similar: PubMed:21441910, PubMed:29433126), and can phosphorylate PFKFB2 (by similar: PubMed:36402789). Additionally, it may play a role in the postsynaptic responses of hippocampal neurons (by similar: PubMed:1508179).

This product does not contain protein kinase domain.

Human

E. coli

Flag

P15056 (P155-N229)

673

Partial

PIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLEN

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 150 mM NaCl, 5% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.