BRAF Protein, Human (Flag)
Based on 1 Customer Validation
BRAF Protein, Human (Inactive, Flag) is the recombinant human-derived BRAF, expressed by E. coli , with Flag labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
BRAF Protein, Human (Inactive, Flag) is the recombinant human-derived BRAF, expressed by E. coli , with Flag labeled tag.
Background
BRAF is a protein kinase involved in transducing mitogenic signals from the cell membrane to the nucleus (Probable). It phosphorylates MAP2K1, activating the MAP kinase signal transduction pathway (by similar: PubMed:21441910, PubMed:29433126), and can phosphorylate PFKFB2 (by similar: PubMed:36402789). Additionally, it may play a role in the postsynaptic responses of hippocampal neurons (by similar: PubMed:1508179).
Verified Bioactivity
This product does not contain protein kinase domain.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Flag
-
Accession
P15056 (P155-N229)
-
Gene ID673
-
Protein Length
Full Length of RBD Domain
-
Synonyms
BRAF; V-Raf Murine Sarcoma Viral Oncogene-Like Protein B1; B-Raf Proto-Oncogene, Serine/Threonine Kinase; Murine Sarcoma Viral (V-Raf) Oncogene Homolog B1; BRAF1; Serine/Threonine-Protein Kinase B-Raf Variant; BRAF-1; Non-Specific Serine/Threonine Protein
-
AA Sequence
PIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLEN
-
Predicted Molecular Mass
9.7 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 150 mM NaCl, 5% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (234 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)