BRDT Protein, Human

The BRDT protein is a testis-specific chromatin factor that is essential for acetylated histones and specifically recognizes H4K5ac and H4K8ac. It plays a key role in spermatogenesis by promoting gene activation at specific developmental stages in late pachytene spermatocytes. BRDT Protein, Human is the recombinant human-derived BRDT protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The BRDT protein is a testis-specific chromatin factor that is essential for acetylated histones and specifically recognizes H4K5ac and H4K8ac. It plays a key role in spermatogenesis by promoting gene activation at specific developmental stages in late pachytene spermatocytes. BRDT Protein, Human is the recombinant human-derived BRDT protein, expressed by E. coli , with tag free.

Background

The BRDT protein, a testis-specific chromatin factor, exhibits a distinctive affinity for histone H4 acetylated at 'Lys-5' and 'Lys-8' (H4K5ac and H4K8ac, respectively), playing a pivotal role in spermatogenesis. Essential in late pachytene spermatocytes, BRDT contributes to meiotic and post-meiotic processes by binding to acetylated histones at specific gene promoters, facilitating their activation at the appropriate developmental stages. In the post-meiotic phase, BRDT engages with hyperacetylated histones, participating in their general removal from DNA. Notably, it recognizes and binds a subset of butyrylated histones, specifically targeting H4K8ac. Beyond its chromatin-binding functions, BRDT acts as a component of the splicing machinery in pachytene spermatocytes and round spermatids, participating in 3'-UTR truncation of specific mRNAs in post-meiotic spermatids. Its significance extends to chromocenter organization, a structure comprising peri-centromeric heterochromatin. BRDT establishes interactions with various mRNA splicing machinery proteins, including SRSF2, DDX5, HNRNPK, and TARDBP, as well as with P-TEFb components CDK9 and CCNT1/cyclin-T1. Additionally, it interacts with the acetylated N-terminus of histone H1, H2, H3, and H4, highlighting its intricate involvement in chromatin dynamics and gene regulation during spermatogenesis.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • BRDT (N21-E137)
      Accession # Q58F21
    • C-term
  • Protein Length

    Partial

  • Synonyms

    BRDT; BRD6; Bromodomain Testis Associated; Bromodomain, Testis-Specific; CT9; RING3-Like Protein; Bromodomain Testis-Specific Protein; BRDt; Cancer/Testis Antigen 9; SPGF21

  • AA Sequence

    NTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00