BRDT Protein, Human

The BRDT protein is a testis-specific chromatin factor that is essential for acetylated histones and specifically recognizes H4K5ac and H4K8ac. It plays a key role in spermatogenesis by promoting gene activation at specific developmental stages in late pachytene spermatocytes. BRDT Protein, Human is the recombinant human-derived BRDT protein, expressed by E. coli , with tag free.

The BRDT protein, a testis-specific chromatin factor, exhibits a distinctive affinity for histone H4 acetylated at 'Lys-5' and 'Lys-8' (H4K5ac and H4K8ac, respectively), playing a pivotal role in spermatogenesis. Essential in late pachytene spermatocytes, BRDT contributes to meiotic and post-meiotic processes by binding to acetylated histones at specific gene promoters, facilitating their activation at the appropriate developmental stages. In the post-meiotic phase, BRDT engages with hyperacetylated histones, participating in their general removal from DNA. Notably, it recognizes and binds a subset of butyrylated histones, specifically targeting H4K8ac. Beyond its chromatin-binding functions, BRDT acts as a component of the splicing machinery in pachytene spermatocytes and round spermatids, participating in 3'-UTR truncation of specific mRNAs in post-meiotic spermatids. Its significance extends to chromocenter organization, a structure comprising peri-centromeric heterochromatin. BRDT establishes interactions with various mRNA splicing machinery proteins, including SRSF2, DDX5, HNRNPK, and TARDBP, as well as with P-TEFb components CDK9 and CCNT1/cyclin-T1. Additionally, it interacts with the acetylated N-terminus of histone H1, H2, H3, and H4, highlighting its intricate involvement in chromatin dynamics and gene regulation during spermatogenesis.

Human

E. coli

Tag Free

Q58F21 (N21-E137)

676

Partial

NTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.