1. Recombinant Proteins
  2. CD Antigens Enzymes & Regulators
  3. Epithelial cell CD Proteins Hydrolases (EC 3)
  4. CD157 Protein, Cynomolgus (HEK293, His)

CD157 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD157 protein, expressed by HEK293, with C-His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD157 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD157 protein, expressed by HEK293, with C-His tag.

Background

CD157, also known as bone marrow stromal antigen 1 (BST-1), is a multifunctional protein that catalyzes both the synthesis and hydrolysis of cyclic ADP-beta-D-ribose (cADPR) from and to NAD(+), respectively. Cyclic ADPR functions as an endogenous second messenger capable of eliciting calcium release from intracellular stores, thereby regulating the mobilization of intracellular calcium, although this function is described as probable. The duality of CD157's enzymatic activities suggests a regulatory role in cellular signaling cascades involving calcium release. Additionally, CD157 is speculated to be involved in pre-B-cell growth, indicating its potential contribution to cellular processes associated with B-cell development. It has to underscore CD157's versatility in cyclic ADP-ribose metabolism and hints at its participation in calcium signaling and cell growth regulation.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5VGB5 (G26-A289)

Gene ID

/

Protein Length

Partial

Synonyms
ADP-ribosyl cyclase; BST1; Cyclic ADP-ribose hydrolase 2; CD157
AA Sequence

GAPSPWHREGTSHSWDIFLGRCAEYRALLSSEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFAGNTRRFMPLSDVLYGRVADFLSWCRQKNASGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGTMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALNSAAATTQRKA

Predicted Molecular Mass
31 kDa
Molecular Weight

Approximately 40-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD157 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD157 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD157 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P703809
Quantity:
MCE Japan Authorized Agent: