CD157 Protein, Cynomolgus (HEK293, His)
CD157 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD157 protein, expressed by HEK293, with C-His tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD157 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD157 protein, expressed by HEK293, with C-His tag.
Background
CD157, also known as bone marrow stromal antigen 1 (BST-1), is a multifunctional protein that catalyzes both the synthesis and hydrolysis of cyclic ADP-beta-D-ribose (cADPR) from and to NAD(+), respectively. Cyclic ADPR functions as an endogenous second messenger capable of eliciting calcium release from intracellular stores, thereby regulating the mobilization of intracellular calcium, although this function is described as probable. The duality of CD157's enzymatic activities suggests a regulatory role in cellular signaling cascades involving calcium release. Additionally, CD157 is speculated to be involved in pre-B-cell growth, indicating its potential contribution to cellular processes associated with B-cell development. It has to underscore CD157's versatility in cyclic ADP-ribose metabolism and hints at its participation in calcium signaling and cell growth regulation.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5VGB5 (G26-A289)
-
Gene ID/
-
Protein Length
Partial
-
Synonyms
BST1; NAD(+) Nucleosidase; Bone Marrow Stromal Cell Antigen 1; ADP-Ribosyl Cyclase/Cyclic ADP-Ribose Hydrolase; ADP-Ribosyl Cyclase 2; Bone Marrow Stromal Antigen 1; CADPR2; Cyclic ADP-Ribose Hydrolase; CD157; CADPr Hydrolase 2; BST-1; CADPR Hydrolase 2;
-
AA Sequence
GAPSPWHREGTSHSWDIFLGRCAEYRALLSSEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFAGNTRRFMPLSDVLYGRVADFLSWCRQKNASGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGTMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALNSAAATTQRKA
-
Predicted Molecular Mass
31 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
