1. Recombinant Proteins
  2. Immune Checkpoint Proteins Biotinylated Proteins
  3. Butyrophilins
  4. BTN3A1/CD277
  5. BTN3A1/CD277 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

BTN3A1/CD277 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P77582
Handling Instructions Technical Support

BTN3A1/CD277 protein belongs to the BTN/MOG family of the immunoglobulin superfamily and may be involved in immune response and cell recognition. Its membership suggests involvement in immune processes, suggesting complex interactions underlying immune regulation. BTN3A1/CD277 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTN3A1/CD277 protein belongs to the BTN/MOG family of the immunoglobulin superfamily and may be involved in immune response and cell recognition. Its membership suggests involvement in immune processes, suggesting complex interactions underlying immune regulation. BTN3A1/CD277 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

BTN3A1/CD277 protein is a member of the immunoglobulin superfamily and is specifically classified within the BTN/MOG family. As part of this family, BTN3A1/CD277 likely plays a role in immune responses and cellular recognition, given the family's involvement in immunological processes. Being a member of the immunoglobulin superfamily suggests that BTN3A1/CD277 might engage in complex interactions contributing to immune regulation. The precise functions and implications of BTN3A1/CD277 within the context of the immunoglobulin superfamily warrant further investigation to deepen our understanding of its role in modulating immune responses.

Species

Cynomolgus

Source

HEK293

Tag

C-Avi;C-8*His

Accession

A0A330KWZ1 (Q1-W219)

Gene ID

/

Molecular Construction
N-term
BTN3A1 (Q1-W219)
Accession # A0A330KWZ1
8*His-Avi
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
CD277; BTN3A1; BTF5; BT3.1; BTN3.1
AA Sequence

QFAVVGPPGPILAMVGEDADLPCHLFPTMSAETMELRWVSSNLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIDVKGYEDGGIHLECRSTGWYPQPQIRWSNDKGENIPAVEAPVFVDGVGLYAVAASVILRGSSGEGVSCTIRSSLLGLEKTTSISIAGPFFRRAQSW

Predicted Molecular Mass
26.5 kDa
Molecular Weight

Approximately 30-35 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BTN3A1/CD277 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BTN3A1/CD277 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTN3A1/CD277 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P77582
Quantity:
MCE Japan Authorized Agent: