BTN3A1/CD277 Protein, Cynomolgus (HEK293, His-Avi)
BTN3A1/CD277 protein belongs to the BTN/MOG family of the immunoglobulin superfamily and may be involved in immune response and cell recognition. Its membership suggests involvement in immune processes, suggesting complex interactions underlying immune regulation. BTN3A1/CD277 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BTN3A1/CD277 protein belongs to the BTN/MOG family of the immunoglobulin superfamily and may be involved in immune response and cell recognition. Its membership suggests involvement in immune processes, suggesting complex interactions underlying immune regulation. BTN3A1/CD277 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
BTN3A1/CD277 protein is a member of the immunoglobulin superfamily and is specifically classified within the BTN/MOG family. As part of this family, BTN3A1/CD277 likely plays a role in immune responses and cellular recognition, given the family's involvement in immunological processes. Being a member of the immunoglobulin superfamily suggests that BTN3A1/CD277 might engage in complex interactions contributing to immune regulation. The precise functions and implications of BTN3A1/CD277 within the context of the immunoglobulin superfamily warrant further investigation to deepen our understanding of its role in modulating immune responses.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
A0A330KWZ1 (Q1-W219)
-
Gene ID/
-
Molecular Construction
-
N-term
-
BTN3A1 (Q1-W219)
Accession # A0A330KWZ1 -
8*His-Avi
-
C-term
-
-
Protein Length
Partial
-
Synonyms
BTN3A1; CD277; Butyrophilin Subfamily 3 Member A1; DJ45P21.3 (Butyrophilin, Subfamily 3, Member A1); BTF5; Butyrophilin, Subfamily 3, Member A1; BTN3.1; CD277 Antigen; BT3.1
-
AA Sequence
QFAVVGPPGPILAMVGEDADLPCHLFPTMSAETMELRWVSSNLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIDVKGYEDGGIHLECRSTGWYPQPQIRWSNDKGENIPAVEAPVFVDGVGLYAVAASVILRGSSGEGVSCTIRSSLLGLEKTTSISIAGPFFRRAQSW
-
Predicted Molecular Mass
26.5 kDa
-
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
