1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Butyrophilins
  4. BTN3A1/CD277
  5. BTN3A1/CD277 Protein, Cynomolgus (HEK293, His-Avi)

BTN3A1/CD277 Protein, Cynomolgus (HEK293, His-Avi)

Cat. No.: HY-P77581
Handling Instructions Technical Support

BTN3A1/CD277 protein belongs to the BTN/MOG family of the immunoglobulin superfamily and may be involved in immune response and cell recognition. Its membership suggests involvement in immune processes, suggesting complex interactions underlying immune regulation. BTN3A1/CD277 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
100 μg 견적 받기 2 - 3 weeks 1 - 2 Weeks 3 - 4 weeks 2 - 3 weeks
> 100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

BTN3A1/CD277 protein belongs to the BTN/MOG family of the immunoglobulin superfamily and may be involved in immune response and cell recognition. Its membership suggests involvement in immune processes, suggesting complex interactions underlying immune regulation. BTN3A1/CD277 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

BTN3A1/CD277 protein is a member of the immunoglobulin superfamily and is specifically classified within the BTN/MOG family. As part of this family, BTN3A1/CD277 likely plays a role in immune responses and cellular recognition, given the family's involvement in immunological processes. Being a member of the immunoglobulin superfamily suggests that BTN3A1/CD277 might engage in complex interactions contributing to immune regulation. The precise functions and implications of BTN3A1/CD277 within the context of the immunoglobulin superfamily warrant further investigation to deepen our understanding of its role in modulating immune responses.

Biological Activity

Immobilized Cynomolgus BTN3A1, His Tag at 0.5μg/ml (100μl/Well) on the plate. Dose response curve for Anti-BTN3A1 Antibody, hFc Tag with the EC50 of 10.9ng/ml determined by ELISA.

Species

Cynomolgus

Source

HEK293

Tag

C-Avi;C-8*His

Accession

A0A330KWZ1 (Q1-W219)

Gene ID

/

Molecular Construction
N-term
BTN3A1 (Q1-W219)
Accession # A0A330KWZ1
8*His-Avi
C-term
Protein Length

Partial

Synonyms
CD277; BTN3A1; BTF5; BT3.1; BTN3.1
AA Sequence

QFAVVGPPGPILAMVGEDADLPCHLFPTMSAETMELRWVSSNLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIDVKGYEDGGIHLECRSTGWYPQPQIRWSNDKGENIPAVEAPVFVDGVGLYAVAASVILRGSSGEGVSCTIRSSLLGLEKTTSISIAGPFFRRAQSW

Predicted Molecular Mass
26.5 kDa
분자량

Approximately 30-35 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류

BTN3A1/CD277 Protein, Cynomolgus (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

BTN3A1/CD277 Protein, Cynomolgus (HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
BTN3A1/CD277 Protein, Cynomolgus (HEK293, His-Avi)
Cat. No.:
HY-P77581
수량:
MCE Japan Authorized Agent: