CD93/C1qR1 Protein, Human (HEK293, hFc)
The CD93/C1qR1 protein is thought to be a receptor or part of a larger complex and plays a crucial role in immune recognition by binding to C1q, mannose-binding lectin (MBL2), and pulmonary surfactant protein A (SPA) . Its interaction with these immune factors suggests a role in coordinating the innate immune response. CD93/C1qR1 Protein, Human (HEK293, hFc) is the recombinant human-derived C1qR1/CD93 protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD93/C1qR1 protein is thought to be a receptor or part of a larger complex and plays a crucial role in immune recognition by binding to C1q, mannose-binding lectin (MBL2), and pulmonary surfactant protein A (SPA) . Its interaction with these immune factors suggests a role in coordinating the innate immune response. CD93/C1qR1 Protein, Human (HEK293, hFc) is the recombinant human-derived C1qR1/CD93 protein, expressed by HEK293, with C-hFc labeled tag.
Background
CD93/C1qR1 Protein, identified as a receptor or a component of a larger receptor complex, plays a crucial role in immune recognition by serving as a binding site for C1q, mannose-binding lectin (MBL2), and pulmonary surfactant protein A (SPA). Its interaction with these immune factors suggests a role in orchestrating innate immune responses. CD93/C1qR1 may also participate in the modulation of phagocytosis in monocytes and macrophages, particularly when interacting with soluble defense collagens. Additionally, it appears to be involved in intercellular adhesion, indicating a potential role in cellular interactions beyond immune recognition. The observed interaction with C1QBP further implies its association with cell surface C1q, highlighting the intricate involvement of CD93/C1qR1 in immune-related processes and suggesting its significance in cellular responses to external challenges.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9NPY3 (T22-K580)
-
Gene ID22918
-
Protein Length
Extracellular Domain
-
Synonyms
CD93; DJ737E23.1; Prev. C1QR1; ECSM3; Prev. MXRA4; Matrix-Remodeling-Associated Protein 4; C1qR(P); Matrix-Remodelling Associated 4; CDw93; C1qR; Complement Component 1 Q Subcomponent Receptor 1; Complement Component 1, Q Subcomponent, Receptor 1; Complem
-
AA Sequence
TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK
-
Predicted Molecular Mass
85.2 kDa
-
Molecular Weight
Approximately 125 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
