CA125 Protein, Human (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

The CA125 protein acts by binding to MSLN and plays a crucial role in forming a protective and lubricating barrier on mucosal surfaces. This interaction promotes heterotypic cell adhesion and is suggested to play an important role in peritoneal metastasis of ovarian cancer. CA125 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CA125 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CA125 protein acts by binding to MSLN and plays a crucial role in forming a protective and lubricating barrier on mucosal surfaces. This interaction promotes heterotypic cell adhesion and is suggested to play an important role in peritoneal metastasis of ovarian cancer. CA125 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CA125 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

CA125 protein is believed to serve a crucial role in establishing a protective and lubricating barrier against particles and infectious agents at mucosal surfaces. It exerts its functions through binding to MSLN, where the interaction mediates heterotypic cell adhesion. This adhesive property may play a significant role in the metastasis of ovarian cancer to the peritoneum, as CA125 initiates cell attachment to the mesothelial epithelium by binding to MSLN. The interaction between CA125 and MSLN underscores its potential involvement in the adhesive events associated with cancer metastasis, particularly in the context of ovarian cancer progression to the peritoneal cavity.

Verified Bioactivity

Immobilized Human MSLN, hFc Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human CA125, His Tag with the EC50 of 0.24 μg/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CA125 (G12660-M12923)
      Accession # Q8WXI7
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    MUC16; FLJ14303; Mucin 16, Cell Surface Associated; Mucin-16; CA125; CA125 Ovarian Cancer Antigen; CA-125; Mucin-16 Short Isoform; Ovarian Cancer-Related Tumor Marker CA125; Mucin-16 Long Isoform; Ovarian Carcinoma Antigen CA125; MUC-16; Cancer Antigen 12

  • AA Sequence

    GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM

  • Predicted Molecular Mass

    31.3 kDa

  • Molecular Weight

    Approximately 52-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00