BCAM Protein, Human (HEK293, His)
Based on 1 Customer Validation
BCAM Protein, operating as a laminin alpha-5 receptor, potentially engages in mediating intracellular signaling. BCAM Protein, Human (HEK293, His) is the recombinant human-derived BCAM protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
BCAM Protein, operating as a laminin alpha-5 receptor, potentially engages in mediating intracellular signaling. BCAM Protein, Human (HEK293, His) is the recombinant human-derived BCAM protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The BCAM protein functions as a laminin alpha-5 receptor and may play a role in mediating intracellular signaling.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P50895 (E32-A547)
-
Molecular Construction
-
N-term
-
BCAM (E32-A547)
Accession # P50895 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
BCAM; F8/G253 Antigen; Prev. LU; Lutheran Blood Group (Auberger B Antigen Included); B-CAM Cell Surface Glycoprotein; Basal Cell Adhesion Molecule Lutheran Blood Group; Basal Cell Adhesion Molecule; Lutheran Blood Group Variant LUGA; F8/G253; Lutheran Blo
-
AA Sequence
EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQA
-
Predicted Molecular Mass
57 kDa
-
Molecular Weight
Approximately 72-85 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Yamato Kikkawa, et al. The lutheran/basal cell adhesion molecule promotes tumor cell migration by modulating integrin-mediated cell attachment to laminin-511 protein. J Biol Chem. 2013 Oct 25;288(43):30990-1001. [Content Brief]
[2]. Kais Hussein, et al. Expression of adhesion factor CD239 in bone marrow cells in chronic myeloproliferative diseases. J Thromb Thrombolysis. 2009 Oct;28(3):299-303. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
