CAM Protein, Human (HEK293, His)

CAM Protein, operating as a laminin alpha-5 receptor, potentially engages in mediating intracellular signaling. CAM Protein, Human (HEK293, His) is the recombinant human-derived CAM protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CAM Protein, Human (HEK293, His) is 516 a.a., with molecular weight of 72-85 kDa.

The CAM protein functions as a laminin alpha-5 receptor and may play a role in mediating intracellular signaling.

Human

HEK293

C-6*His

P50895 (E32-A547)

4059  [NCBI]

EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAHHHHHH

72-85 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Yamato Kikkawa, et al. The lutheran/basal cell adhesion molecule promotes tumor cell migration by modulating integrin-mediated cell attachment to laminin-511 protein. J Biol Chem. 2013 Oct 25;288(43):30990-1001.  [Content Brief]

  [2]. Kais Hussein, et al. Expression of adhesion factor CD239 in bone marrow cells in chronic myeloproliferative diseases. J Thromb Thrombolysis. 2009 Oct;28(3):299-303.  [Content Brief]