Can f 1 Protein, Canine (HEK293, His)
Based on 1 Customer Validation
Can f 1 Protein is a major dog allergen. It is a protein produced in the canine VonEbner's glands and the possible role of the protein is in taste reception. Can f 1 is mainly derived from dog dander, pelt hair and saliva. Exposure and sensitization to dog allergen is a significant cause of asthma. Can f 1 Protein, Canine (HEK293, His) is the recombinant canine-derived Can f 1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Can f 1 Protein is a major dog allergen. It is a protein produced in the canine VonEbner's glands and the possible role of the protein is in taste reception. Can f 1 is mainly derived from dog dander, pelt hair and saliva. Exposure and sensitization to dog allergen is a significant cause of asthma. Can f 1 Protein, Canine (HEK293, His) is the recombinant canine-derived Can f 1 protein, expressed by HEK293 , with C-His labeled tag.
Background
Canf1 is a major dog allergen. It is a protein produced in the canine VonEbner's glands and the possible role of the protein is in taste reception. Canf1 is mainly derived from dog dander, pelt hair and saliva. Exposure and sensitization to dog allergen is a significant cause of asthma[1].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-6*His
-
Accession
O18873/NP_001003190.1 (Q19-Q174)
-
Molecular Construction
-
N-term
-
Canf1 (Q19-Q174)
Accession # O18873/NP_001003190.1 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Major allergen Can f 1; Allergen Dog 1; Can f 1
-
AA Sequence
QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQ
-
Molecular Weight
Approximately 19-24 kDa due to the glycosylation
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
