DCP2 Protein, Human (His, Strep)
CARD11 Protein, Human (His, Strep, M95-P260) is the recombinant human-derived CARD11, expressed by E. coli, with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CARD11 Protein, Human (His, Strep, M95-P260) is the recombinant human-derived CARD11, expressed by E. coli, with Strep, His labeled tag.
Background
DCP2 is a decapping metalloenzyme that catalyzes the cleavage of the cap structure on mRNAs. It removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. DCP2 is essential for mRNA degradation in both normal mRNA turnover and nonsense-mediated mRNA decay, and plays a role in replication-dependent histone mRNA degradation. It exhibits higher activity towards mRNAs lacking a poly(A) tail but shows no activity towards a cap structure without an RNA moiety. The presence of an N(6),2'-O-dimethyladenosine cap (m6A(m)) at the second transcribed position of mRNAs confers resistance to DCP2-mediated decapping. Under nutrient-rich conditions, DCP2 blocks autophagy by repressing the expression of ATG-related genes through degradation of their transcripts.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q8IU60-1 (M95-P260)
-
Gene ID167227
-
Protein Length
Partial
-
Synonyms
DCP2; DCP2 Decapping Enzyme Homolog (S. Cerevisiae), Isoform CRA_b; Decapping MRNA 2; CDNA FLJ52185, Highly Similar To MRNA Decapping Enzyme 2; NUDT20; Nucleoside Diphosphate-Linked Moiety X Motif 20; Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Mo
-
AA Sequence
MGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTP
-
Predicted Molecular Mass
21.9 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
