Cardiotrophin-1/CTF1 Protein, Human (HEK293)

Cardiotrophin-1/CTF1 protein induces cardiac myocyte hypertrophy in vitro by binding to and activating the ILST/gp130 receptor, highlighting its regulatory role in heart muscle cell enlargement. This engagement orchestrates signaling events that contribute to the hypertrophic response, providing insight into the mechanisms of cardiac hypertrophy and implicating Cardiotrophin-1 in heart muscle growth. Cardiotrophin-1/CTF1 Protein, Human (HEK293) is the recombinant human-derived Cardiotrophin-1/CTF1 protein, expressed by HEK293 , with tag free.

Cardiotrophin-1/CTF1 protein serves as a potent inducer of cardiac myocyte hypertrophy in vitro, underscoring its regulatory role in the enlargement of heart muscle cells. This effect is mediated through its binding to and activation of the ILST/gp130 receptor, indicating a specific molecular pathway through which Cardiotrophin-1 exerts its influence. By engaging with the ILST/gp130 receptor, Cardiotrophin-1 orchestrates signaling events that contribute to the hypertrophic response in cardiac myocytes. This molecular insight into the interaction between Cardiotrophin-1 and its receptor provides a foundational understanding of the mechanisms underlying cardiac hypertrophy and implicates this protein in the modulation of heart muscle growth.

Human

HEK293

Tag Free

Q16619-1 (S2-A201)

1489  [NCBI]

Partial

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Approximately 26.6 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/cho-cell.html  [Content Brief]