Cardiotrophin-1/CTF1 Protein, Human (HEK293)
Cardiotrophin-1/CTF1 protein induces cardiac myocyte hypertrophy in vitro by binding to and activating the ILST/gp130 receptor, highlighting its regulatory role in heart muscle cell enlargement. This engagement orchestrates signaling events that contribute to the hypertrophic response, providing insight into the mechanisms of cardiac hypertrophy and implicating Cardiotrophin-1 in heart muscle growth. Cardiotrophin-1/CTF1 Protein, Human (HEK293) is the recombinant human-derived Cardiotrophin-1/CTF1 protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cardiotrophin-1/CTF1 protein induces cardiac myocyte hypertrophy in vitro by binding to and activating the ILST/gp130 receptor, highlighting its regulatory role in heart muscle cell enlargement. This engagement orchestrates signaling events that contribute to the hypertrophic response, providing insight into the mechanisms of cardiac hypertrophy and implicating Cardiotrophin-1 in heart muscle growth. Cardiotrophin-1/CTF1 Protein, Human (HEK293) is the recombinant human-derived Cardiotrophin-1/CTF1 protein, expressed by HEK293 , with tag free.
Background
Cardiotrophin-1/CTF1 protein serves as a potent inducer of cardiac myocyte hypertrophy in vitro, underscoring its regulatory role in the enlargement of heart muscle cells. This effect is mediated through its binding to and activation of the ILST/gp130 receptor, indicating a specific molecular pathway through which Cardiotrophin-1 exerts its influence. By engaging with the ILST/gp130 receptor, Cardiotrophin-1 orchestrates signaling events that contribute to the hypertrophic response in cardiac myocytes. This molecular insight into the interaction between Cardiotrophin-1 and its receptor provides a foundational understanding of the mechanisms underlying cardiac hypertrophy and implicates this protein in the modulation of heart muscle growth.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q16619-1 (S2-A201)
-
Molecular Construction
-
N-term
-
CTF1 (S2-A201)
Accession # Q16619-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CTF1; CT1; Cardiotrophin 1; Cardiotrophin-1; CT-1; Cardiophin 1
-
AA Sequence
SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
-
Predicted Molecular Mass
21.2 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
