Caspase-10/CASP10 Protein, Human (His-GST)
Based on 1 Customer Validation
Caspase-10/CASP10 Protein, Human (His-GST) is an approximately 54.2 kDa caspase-10 protein with a His-GST-tag, expressed in E. coli. Caspase-10 belongs to the caspase family and involved in the execution-phase of cell apoptosis.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Caspase-10/CASP10 Protein, Human (His-GST) is an approximately 54.2 kDa caspase-10 protein with a His-GST-tag, expressed in E. coli. Caspase-10 belongs to the caspase family and involved in the execution-phase of cell apoptosis[1].
Background
Caspase-10 (CASP10) is a 521 amino acid protein member of the cysteine-aspartic acid protease (caspase) family. Caspase-10 contains two DED (Death Effector) domains and can be detected in many tissues[1]. Caspases are a family of cytosolic aspartate-specific cysteine proteases involved in the execution-phase of cell apoptosis, CASP10 is cleaved to two active subunits: Caspase-10 subunit p23/17, Caspase-10 subunit p12[2]. Caspase-10 belongs to the apoptosis initiation caspase (caspase-2, -8, -9, -and -10). Caspase-10 cleavage activates caspases 3 and 7, but itself is processed by caspase 8[3].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-GST
-
Accession
Q92851 (V220-D415)
-
Gene ID843
-
Molecular Construction
-
N-term
-
6*His-GST
-
CASP10 (V220-D415)
Accession # Q92851 -
C-term
-
-
Protein Length
Full Length of Caspase-10 subunit p23/17 Chain
-
Synonyms
CASP10; Caspase 10 Apoptosis-Related Cysteine Peptidase Isoform 3; Caspase 10; Caspase 10, Apoptosis-Related Cysteine Peptidase; MCH4; Caspase 10 Apoptosis-Related Cysteine Peptidase; FAS-Associated Death Domain Protein Interleukin-1B-Converting Enzyme 2;
-
AA Sequence
VKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEAD
-
Predicted Molecular Mass
54.2 kDa
-
Molecular Weight
Approximately 54 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
