Copy Link Print Information

CCND3 Protein, Human (Biotinylated, MBP, His, Flag)

Customer Review

Based on 1 Customer Validation

CCND3 Protein, Human (Biotinylated, MBP, His, Flag) is the recombinant human-derived CCND3, expressed by E.coli , with MBP, His, Flag labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • CCND3 Protein, Human (Biotinylated, MBP, His, Flag) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CCND3 Protein, Human (Biotinylated, MBP, His, Flag) is the recombinant human-derived CCND3, expressed by E.coli , with MBP, His, Flag labeled tag.

Background

Cyclin D3 is a regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits retinoblastoma (RB) protein family members, including RB1, thereby regulating the cell cycle during G(1)/S transition. Phosphorylation of RB1 triggers the dissociation of the transcription factor E2F from the RB/E2F complex, leading to the transcription of E2F target genes essential for G(1) phase progression. Cyclin D3-CDK4 complexes serve as key integrators of mitogenic and antimitogenic signals. Additionally, Cyclin D3 forms part of the ternary complex cyclin D3/CDK4/CDKN1B, which is required for the nuclear translocation and activity of the cyclin D-CDK4 complex. Cyclin D3 also exhibits CDK4-independent transcriptional coactivator activity in collaboration with ATF5.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His;C-Avi;N-MBP
  • Accession

    P30281-1 (M1-L292)

  • Gene ID
    896
  • Molecular Construction
    • N-term
    • MBP
    • CCND3 (M1-L292)
      Accession # P30281-1
    • 6*His
    • Avi
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Conjugation

    Biotin

  • Synonyms

    CCND3; G1/S-Specific Cyclin-D3; Cyclin D3; D3-Type Cyclin

  • AA Sequence

    MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

  • Predicted Molecular Mass

    80.3 kDa

  • Molecular Weight

    Approximately 80 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4, 10% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CCND3 Protein, Human (Biotinylated, MBP, His, Flag) Product Image
    1/16
  • CCND3 Protein, Human (Biotinylated, MBP, His, Flag) Product Image