1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Chemokine & Receptors G-Protein-Coupled Receptors (GPCRs) Cytokine Receptors
  4. CC Chemokine Receptor Chemokine Receptor
  5. CCR5
  6. CCR5 Protein-VLP, Human (HEK293, GFP)

CCR5 Protein-VLP, Human (HEK293, GFP) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CCR5 Protein-VLP, Human (HEK293, GFP) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.

Background

CCR5 functions as a receptor for several inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, leading to the transduction of signals that elevate intracellular calcium ion levels. This receptor is implicated in the regulation of granulocytic lineage proliferation or differentiation and plays a crucial role in facilitating T-lymphocyte migration to infection sites by acting as a chemotactic receptor. In the context of microbial infection, CCR5 acts as a coreceptor, with CD4 being the primary receptor, for human immunodeficiency virus-1/HIV-1, underscoring its significance in the cellular response to infections.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P51681 (M1-L352)

Gene ID

1234

Molecular Construction
N-term
CCR5 (M1-L352)
Accession # P51681
C-term
Protein Length

Full Length

Synonyms
CCR5; chemokine (C-C motif) receptor 5 (gene/pseudogene); chemokine (C C motif) receptor 5, CMKBR5; C-C chemokine receptor type 5; CC CKR 5; CD195; CKR 5; CKR5; IDDM22; chemr13; HIV-1 fusion coreceptor; chemokine receptor CCR5; C-C motif chemokine receptor 5 A159A; CCR-5; CKR-5; CCCKR5; CMKBR5
AA Sequence

MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Glycosylation
Yes
Purity

Purity analysis by SDS-PAGE is not available for VLP proteins.

Appearance

Solution.

Formulation

Supplied as 0.2 μm filtered solution of PBS, Arginine, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CCR5 Protein-VLP, Human (HEK293, GFP)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CCR5 Protein-VLP, Human (HEK293, GFP)
Cat. No.:
HY-P704435
수량:
MCE Japan Authorized Agent: