CD133/PROM1 Protein, Rat (HEK293, His)
Based on 1 publication(s) in Google Scholar
The CD133/PROM1 protein is critical for multiple processes including glomerular epithelial cell differentiation and retinal morphogenesis, showing biased expression in tissues such as lung and kidney. CD133/PROM1 Protein, Rat (HEK293, His) is the recombinant rat-derived CD133/PROM1 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The CD133/PROM1 protein is critical for multiple processes including glomerular epithelial cell differentiation and retinal morphogenesis, showing biased expression in tissues such as lung and kidney. CD133/PROM1 Protein, Rat (HEK293, His) is the recombinant rat-derived CD133/PROM1 protein, expressed by HEK293 , with N-His labeled tag.
Background
CD133/PROM1 Protein is predicted to possess actinin binding activity, cadherin binding activity, and cholesterol binding activity. The protein is anticipated to be involved in various processes, including glomerular epithelial cell differentiation, photoreceptor cell maintenance, and retina morphogenesis in camera-type eyes. Predicted to be located in cellular components such as the endoplasmic reticulum-Golgi intermediate compartment, extracellular exosome, and photoreceptor outer segment membrane, CD133 is expected to be active in cellular components like the apical plasma membrane, microvillus, and prominosome. Additionally, it is predicted to be an integral component of the plasma membrane. CD133 is used in the study of diabetes mellitus and is implicated in human conditions such as cone-rod dystrophy 12 and retinitis pigmentosa 41. Notably, CD133 exhibits biased expression in tissues, with prominent levels observed in the lung, kidney, and eight other tissues, suggesting its diverse functional roles in these organs.
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag N-His
-
Accession
NP_001103607.1 (N171-Y424)
-
Molecular Construction
-
N-term
-
His
-
CD133 (N171-Y424)
Accession # NP_001103607.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PROM1; AC133 Antigen; Prev. PROML1; Prominin-1; Prev. STGD4; Stargardt Disease 4 (Autosomal Dominant); Prev. MCDR2; Hematopoietic Stem Cell Antigen; CORD12; Macular Dystrophy, Retinal 2; CD133; Prominin (Mouse)-Like 1; AC133; CD133 Isoform H; RP41; CD133
-
AA Sequence
NQQTRTRIQRTQKLAESNYRDLRALLTEAPKQIDYILGQYNTTKNKAFSDLDSIDSVLGGRIKGQLKPKVTPVLEEIKAMATAIRQTKDALQNMSSSLKSLRDASTQLSTNLTSVRNSIENSLNSNDCASDPASKICDSLRPQLSNLGSNHNGSQLPSVDRELNTVNDVDRTDLESLVKRGYMSIDEIPNMIQNQTGDVIKDVKKTLDSVSSKVKNMSQSIPVEEVLLQFSHYLNDSNRYIHESLPRVEEYDSY
-
Predicted Molecular Mass
30.9 kDa
-
Molecular Weight
Approximately 47-57 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)