1. Recombinant Proteins
  2. CD Antigens
  3. Stem Cell CD Proteins
  4. CD133
  5. CD133/PROM1 Protein, Rat (HEK293, His)

The CD133/PROM1 protein is critical for multiple processes including glomerular epithelial cell differentiation and retinal morphogenesis, showing biased expression in tissues such as lung and kidney. CD133/PROM1 Protein, Rat (HEK293, His) is the recombinant rat-derived CD133/PROM1 protein, expressed by HEK293 , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE CD133/PROM1 Protein, Rat (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The CD133/PROM1 protein is critical for multiple processes including glomerular epithelial cell differentiation and retinal morphogenesis, showing biased expression in tissues such as lung and kidney. CD133/PROM1 Protein, Rat (HEK293, His) is the recombinant rat-derived CD133/PROM1 protein, expressed by HEK293 , with N-His labeled tag.

Background

CD133/PROM1 Protein is predicted to possess actinin binding activity, cadherin binding activity, and cholesterol binding activity. The protein is anticipated to be involved in various processes, including glomerular epithelial cell differentiation, photoreceptor cell maintenance, and retina morphogenesis in camera-type eyes. Predicted to be located in cellular components such as the endoplasmic reticulum-Golgi intermediate compartment, extracellular exosome, and photoreceptor outer segment membrane, CD133 is expected to be active in cellular components like the apical plasma membrane, microvillus, and prominosome. Additionally, it is predicted to be an integral component of the plasma membrane. CD133 is used in the study of diabetes mellitus and is implicated in human conditions such as cone-rod dystrophy 12 and retinitis pigmentosa 41. Notably, CD133 exhibits biased expression in tissues, with prominent levels observed in the lung, kidney, and eight other tissues, suggesting its diverse functional roles in these organs.

Species

Rat

Source

HEK293

Tag

N-His

Accession

NP_001103607.1 (N171-Y424)

Gene ID
Molecular Construction
N-term
His
CD133 (N171-Y424)
Accession # NP_001103607.1
C-term
Protein Length

Partial

Synonyms
Prominin-1; Antigen AC133; CD133; PROM1; PROML1; MSTP061
AA Sequence

NQQTRTRIQRTQKLAESNYRDLRALLTEAPKQIDYILGQYNTTKNKAFSDLDSIDSVLGGRIKGQLKPKVTPVLEEIKAMATAIRQTKDALQNMSSSLKSLRDASTQLSTNLTSVRNSIENSLNSNDCASDPASKICDSLRPQLSNLGSNHNGSQLPSVDRELNTVNDVDRTDLESLVKRGYMSIDEIPNMIQNQTGDVIKDVKKTLDSVSSKVKNMSQSIPVEEVLLQFSHYLNDSNRYIHESLPRVEEYDSY

분자량

47-57 kDa.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류

CD133/PROM1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD133/PROM1 Protein, Rat (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD133/PROM1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P76196
수량:
MCE Japan Authorized Agent: