CD19 Protein, Mouse (Biotinylated, HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca(2+) mobilization. CD19 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca(2+) mobilization. CD19 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD19 protein functions as a coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes, effectively reducing the threshold for downstream signaling pathways and initiating B-cell responses to antigens. It activates signaling cascades leading to phosphatidylinositol 3-kinase activation and mobilization of intracellular Ca(2+) stores. While not essential for early B cell differentiation in the bone marrow, CD19 is crucial for the normal differentiation of B-1 cells and plays a vital role in B cell differentiation and proliferation in response to antigen challenges. Furthermore, CD19 is required for maintaining normal levels of serum immunoglobulins and the production of high-affinity antibodies upon antigen exposure. CD19 interacts with CR2/CD21 and forms a complex with CD81, CR2/CD21, CD81, and IFITM1/CD225 in the membrane of mature B-cells. It also interacts directly with CD81, essential for trafficking and compartmentalization of the CD19 receptor on the cell surface when phosphorylated on specific tyrosine residues. Additionally, CD19 interacts with PLCG2 when phosphorylated on Tyr-402 and with LYN, and it forms an interaction with the regulatory p85 subunit of phosphatidylinositol 3-kinase (PI3K) when tyrosine phosphorylated.

Verified Bioactivity

Immobilized human CD81 (HY-P72706) at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse CD19 Protein. The ED50 for this effect is 21.1 μg/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized human CD81 (HY-P72706) at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse CD19 Protein. The ED50 for this effect is 21.1 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD19 (G17-G287)
      Accession # P25918
    • His
    • C-term
  • Protein Length

    Extracellular Domain (with Propeptide)

  • Conjugation

    Biotin

  • Conjugate Method

    The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.

  • Synonyms

    CD19; CDNA FLJ60916, Highly Similar To B-Lymphocyte Antigen CD19; CD19 Molecule; CDNA FLJ54955, Highly Similar To B-Lymphocyte Antigen CD19; B-Lymphocyte Surface Antigen B4; CD19 Antigen, Isoform CRA_f; T-Cell Surface Antigen Leu-12; CD19 Antigen, Isoform

  • AA Sequence

    GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

  • Predicted Molecular Mass

    31 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00