CD2 Protein, Canine (HEK293, Fc)
CD2 Protein is a cell surface glycoprotein that is expressed on the surface of T cells, NK cells, thymus cells and dendritic cells. The CD2 Protein mediates the adhesion of T cells to various cell types and triggers T cell responses through interactions with lymphocyte function-related antigens CD58 (LFA-3) and CD48/BCM1. CD2 Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CD2 Protein is a cell surface glycoprotein that is expressed on the surface of T cells, NK cells, thymus cells and dendritic cells. The CD2 Protein mediates the adhesion of T cells to various cell types and triggers T cell responses through interactions with lymphocyte function-related antigens CD58 (LFA-3) and CD48/BCM1. CD2 Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD2 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD2 is a cell surface glycoprotein that plays a crucial role in mediating adhesion between T-cells and various cell types through interactions with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1. Beyond its adhesive function, CD2 is implicated in triggering T-cell responses, with its cytoplasmic domain playing a role in signaling pathways. The protein interacts with CD48, CD58 (LFA-3), CD2AP, and PSTPIP1, contributing to a complex network of molecular interactions. Additionally, the interaction between CD2 and FCGR3A modulates NK cell activation and cytotoxicity, highlighting its diverse involvement in immune cell functions[1][2][3].
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-hFc
-
Accession
XP_849219.1 (E22-D204)
-
Molecular Construction
-
N-term
-
CD2 (E22-D204)
Accession # XP_849219.1 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD2; Rosette Receptor; Prev. SRBC; LFA-2; T-Cell Surface Antigen CD2; Lymphocyte-Function Antigen-2; CD2 Antigen (P50), Sheep Red Blood Cell Receptor; CD2 Antigen; T-Cell Surface Antigen T11/Leu-5; T11; Erythrocyte Receptor; CD2 Molecule; LFA-3 Receptor
-
AA Sequence
EVLETKLVWGALGHDFDLDSAGFQMNAKIDHIRWEKGKTKVAELKTGILKDTHGKYNISTNGFLKIKHLMMNDSDIYKVAIYDKDGKSVLRRNYQLKIQEKVSTPKILWSCGNQSLTCEITSGTDPTLMLYVNQTMIKNLLNMTIVQWNWTSQQEMTVSCTAKNEVSQKREEKIINCSEKGLD
-
Predicted Molecular Mass
47.6 kDa
-
Molecular Weight
Approximately 64 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Binder C, et al. CD2 Immunobiology. Front Immunol. 2020 Jun 9;11:1090. [Content Brief]
[2]. Wilkins AL, et al. Structural biology of the cell adhesion protein CD2: from molecular recognition to protein folding and design. Curr Protein Pept Sci. 2003 Oct;4(5):367-73. [Content Brief]
[3]. Yang JJ, et al. Structural biology of the cell adhesion protein CD2: alternatively folded states and structure-function relation. Curr Protein Pept Sci. 2001 Mar;2(1):1-17. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
