CD20/MS4A1-VLP Protein, Mouse (HEK293)

CD20/MS4A1-VLP Protein, Mouse (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.

CD20/MS4A1 protein is a B-lymphocyte-specific membrane protein that plays a crucial role in regulating cellular calcium influx, which is necessary for the development, differentiation, and activation of B-lymphocytes. It functions as a component of store-operated calcium (SOC) channels, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 protein forms homotetramers and interacts with the heavy and light chains of cell surface IgM, which are the antigen-binding components of the BCR.

Mouse

HEK293

Tag Free

P19437 (M1-P291)

12482

Full Length

MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Purity analysis by SDS-PAGE is not available for VLP proteins.

Solution.

Supplied as 0.2 μm filtered solution of PBS, Arginine, pH7.4 with trehalose as protectant. Due to the cytotoxicity of the detergent, this product is not appropriate for cell - based experiments.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.