CD20/MS4A1-VLP Protein, Mouse (HEK293)
CD20/MS4A1-VLP Protein, Mouse (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD20/MS4A1-VLP Protein, Mouse (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
Background
CD20/MS4A1 protein is a B-lymphocyte-specific membrane protein that plays a crucial role in regulating cellular calcium influx, which is necessary for the development, differentiation, and activation of B-lymphocytes. It functions as a component of store-operated calcium (SOC) channels, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 protein forms homotetramers and interacts with the heavy and light chains of cell surface IgM, which are the antigen-binding components of the BCR.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
P19437 (M1-P291)
-
Gene ID12482
-
Molecular Construction
-
N-term
-
CD20 (M1-P291)
Accession # P19437 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MS4A1; CD20 Antigen; Prev. CD20; B-Lymphocyte Cell-Surface Antigen B1; Bp35; B-Lymphocyte Surface Antigen B1; FMC7; CD20 Receptor; B1; LEU-16; Membrane-Spanning 4-Domains, Subfamily A, Member 1; CVID5; Leukocyte Surface Antigen Leu-16; S7; B-Lymphocyte An
-
AA Sequence
MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
-
Purity
Purity analysis by SDS-PAGE is not available for VLP proteins.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
