CD200R1 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
CD200R1 Protein is an Ig superfamily transmembrane glycoprotein expressed on the surface of myeloid cells. CD200R1 Protein can also be induced in certain T-cell subsets. CD200R1 signaling inhibits the expression of proinflammatory molecules. CD200R1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD200R1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD200R1 Protein is an Ig superfamily transmembrane glycoprotein expressed on the surface of myeloid cells. CD200R1 Protein can also be induced in certain T-cell subsets. CD200R1 signaling inhibits the expression of proinflammatory molecules[1]. CD200R1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD200R1 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD200R1 is an Ig superfamily transmembrane glycoprotein expressed on the surface of myeloid cells; it can also be induced in certain T-cell subsets. CD200R1 interacts with CD200, which is also an Ig superfamily transmembrane glycoprotein, to down regulate myeloid cell functions. CD200 is expressed on the surface of a variety of cells including neurons, epithelial cells, endothelial cells, fibroblasts, lymphoid cells, and astrocytes. The regulation of CD200R1 signaling can occur by posttranslational modification-namely, phosphorylation of tyrosines in the CD200R1 cytoplasmic tail-or by the inducible expression or downregulation of either CD200R1 or CD200. The CD200:CD200R1 inhibitory signaling pathway has been implicated in playing a prominent role in limiting inflammation in a wide range of inflammatory diseases. CD200R1 signaling inhibits the expression of proinflammatory molecules including tumor necrosis factor, interferons, and inducible nitric oxide synthase in response to selected stimuli[1].
Verified Bioactivity
1.Immobilized Cynomolgus CD200R at 2 μg/mL (100 μL/well) can bind Rhesus macaque CD200. The ED50 for this effect is 9.602 ng/mL.
2.Immobilized Cynomolgus CD200R at 0.5 μg/mL (100 μL/well) can bind Rhesus macaque CD200. The ED50 for this effect is ≤24 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
XP_005548207.1 (S47-L267)
-
Molecular Construction
-
N-term
-
CD200R1 (S47-L267)
Accession # XP_005548207.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD200R1; CD200 Cell Surface Glycoprotein Receptor; Prev. MOX2R; MOX2 Receptor; CD200R; Cell Surface Glycoprotein Receptor CD200; OX2R; CD200R1 Protein; HCRTR2; CRTR2; Cell Surface Glycoprotein CD200 Receptor 1; CD200 Receptor 1; Cell Surface Glycoprotein
-
AA Sequence
SNSLCMDEKQITQNHSKVLAEVNISWPVQMARNAVLCCPPIEFRNLIVITWEIILRGQPSCTKTYRKDTNETKETNCTDERITWVSTPDQNSDLQIHPVAITHDGYYRCIMATPDGNFHRGYHLQVLVTPEVTLFESRNRTAVCKAVAGKPAAQISWIPAGDCAPTEQEYWGNGTVTVKSTCHWEGHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKL
-
Molecular Weight
Approximately 43-75 kDa due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
