CD27/TNFRSF7 Protein, Mouse (HEK293, mFc)
CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/NFRSF7 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived CD27/NFRSF7 protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/NFRSF7 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived CD27/NFRSF7 protein, expressed by HEK293 , with C-mFc labeled tag.
Background
The CD27/NFRSF7 Protein serves as a receptor for CD70/CD27L and is implicated in the survival of activated T-cells. Additionally, it may play a role in apoptosis by interacting with SIVA1. The protein forms homodimers and engages with SIVA1 and TRAF2, suggesting its involvement in diverse cellular processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-mFc
-
Accession
P41272 (P24-R182)
-
Molecular Construction
-
N-term
-
CD27 (P24-R182)
Accession # P41272 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD27; T-Cell Activation Antigen CD27; Prev. TNFRSF7; T14; CD27 Antigen; Tumor Necrosis Factor Receptor Superfamily Member 7; S152; T-Cell Activation Antigen S152; Tp55; T Cell Activation Antigen S152; Tumor Necrosis Factor Receptor Superfamily, Member 7;
-
AA Sequence
PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR
-
Predicted Molecular Mass
44.3 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
