2. Protéines recombinantes
  3. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  4. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins
  5. TNF Receptor Superfamily CD27
  6. CD27/TNFRSF7 Protein, Mouse (HEK293, mFc)

CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/NFRSF7 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived CD27/NFRSF7 protein, expressed by HEK293 , with C-mFc labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Obtenir un devis  
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/NFRSF7 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived CD27/NFRSF7 protein, expressed by HEK293 , with C-mFc labeled tag.
Background

The CD27/NFRSF7 Protein serves as a receptor for CD70/CD27L and is implicated in the survival of activated T-cells. Additionally, it may play a role in apoptosis by interacting with SIVA1. The protein forms homodimers and engages with SIVA1 and TRAF2, suggesting its involvement in diverse cellular processes.
Species

Mouse
Source

HEK293
Tag

C-mFc
Accession

P41272 (P24-R182)
Gene ID
Molecular Construction
N-term
CD27 (P24-R182)
Accession # P41272
mFc
C-term
Protein Length

Extracellular Domain
Synonyms
CD27 antigen; Tp55; TNFRSF7; S152; T14; S152. LPFS2; MGC20393; S152CD27L receptor
AA Sequence

PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR

Predicted Molecular Mass
44.2 kDa
Masse moléculaire

Approximately 60-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.
Glycosylation
Yes
Pureté

≥ 95%, as determined by Bis-Tris PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Instruction de manipulation (2659 KB)

CD27/TNFRSF7 Protein, Mouse (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

CD27/TNFRSF7 Protein, Mouse (HEK293, mFc)

  

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

      

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
CD27/TNFRSF7 Protein, Mouse (HEK293, mFc)
Cat. No.:
HY-P78256
Quantité:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nom du produit

  

Lot #

Nom du demandeur *

 

Country or Region *

Adresse e-mail *

     

Numéro de téléphone *

 

Nom de l'organisation *

Remarques

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.