CD27/TNFRSF7 Protein, Mouse (HEK293, His)

CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/TNFRSF7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/TNFRSF7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD27/NFRSF7 Protein serves as a receptor for CD70/CD27L and is implicated in the survival of activated T-cells. Additionally, it may play a role in apoptosis by interacting with SIVA1. The protein forms homodimers and engages with SIVA1 and TRAF2, suggesting its involvement in diverse cellular processes.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD27 (P24-R182)
      Accession # P41272
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD27; T-Cell Activation Antigen CD27; Prev. TNFRSF7; T14; CD27 Antigen; Tumor Necrosis Factor Receptor Superfamily Member 7; S152; T-Cell Activation Antigen S152; Tp55; T Cell Activation Antigen S152; Tumor Necrosis Factor Receptor Superfamily, Member 7;

  • AA Sequence

    PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR

  • Predicted Molecular Mass

    19.6 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00