CD3 zeta/CD247 Protein, Human (His)

CD3 zeta/CD247 is a component of the TCR-CD3 complex and can transmit APC-induced TCR signals to initiate immune responses. CD3D, CD3E, CD3G, and CD3Z contain ITAMs that are phosphorylated by LCK and FYN upon TCR engagement, providing docking sites for ZAP70. CD3 zeta/CD247 Protein, Human (His) is the recombinant human-derived CD3 zeta/CD247 protein, expressed by E. coli , with N-His labeled tag.

CD3 zeta/CD247, an integral component of the TCR-CD3 complex on the T-lymphocyte cell surface, plays a crucial role in adaptive immune responses. When activated by antigen-presenting cells (APCs), the T-cell receptor (TCR)-mediated signals are transmitted across the cell membrane through CD3 chains, including CD3D, CD3E, CD3G, and CD3Z. These chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain, which, upon TCR engagement, become phosphorylated by Src family protein tyrosine kinases LCK and FYN. The phosphorylation of CD3Z ITAMs creates multiple docking sites for the protein kinase ZAP70, leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Beyond its role in signal transduction, CD3Z is essential for intrathymic T-cell differentiation and contributes to the activity-dependent synapse formation of retinal ganglion cells (RGCs) in the retina and dorsal lateral geniculate nucleus (dLGN). The TCR-CD3 complex, comprising heterodimers CD3D/CD3E and CD3G/CD3E, associates preferentially with TCRalpha and TCRbeta, forming trimers. The hexamer interacts with CD3Z homodimers to complete the TCR-CD3 complex, demonstrating its versatility in TCR assembly. Additionally, CD3Z interacts with various proteins, such as SLA, TRAT1, DOCK2, SHB, ZAP70, and others, contributing to its multifaceted functions in immune responses and cellular interactions.

Measured by its ability to inhibit the cell growth of Jurkat cells. The ED₅₀ for this effect is 198.5 ng/mL, corresponding to a specific activity is 5.038×10³ units/mg.

• 
  Measured by its ability to inhibit the cell growth of Jurkat cells. The ED₅₀ for this effect is 198.5 ng/mL, corresponding to a specific activity is 5.038×10³ units/mg.

Human

E. coli

N-His

P20963-1 (R52-R164)

919  [NCBI]

Cytoplasmic Domain

RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Approximately 16 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.