CD3 zeta/CD247 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

CD3 zeta/CD247 is a component of the TCR-CD3 complex and can transmit APC-induced TCR signals to initiate immune responses. CD3D, CD3E, CD3G, and CD3Z contain ITAMs that are phosphorylated by LCK and FYN upon TCR engagement, providing docking sites for ZAP70. CD3 zeta/CD247 Protein, Human (His) is the recombinant human-derived CD3 zeta/CD247 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD3 zeta/CD247 is a component of the TCR-CD3 complex and can transmit APC-induced TCR signals to initiate immune responses. CD3D, CD3E, CD3G, and CD3Z contain ITAMs that are phosphorylated by LCK and FYN upon TCR engagement, providing docking sites for ZAP70. CD3 zeta/CD247 Protein, Human (His) is the recombinant human-derived CD3 zeta/CD247 protein, expressed by E. coli , with N-His labeled tag.

Background

CD3 zeta/CD247, an integral component of the TCR-CD3 complex on the T-lymphocyte cell surface, plays a crucial role in adaptive immune responses. When activated by antigen-presenting cells (APCs), the T-cell receptor (TCR)-mediated signals are transmitted across the cell membrane through CD3 chains, including CD3D, CD3E, CD3G, and CD3Z. These chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain, which, upon TCR engagement, become phosphorylated by Src family protein tyrosine kinases LCK and FYN. The phosphorylation of CD3Z ITAMs creates multiple docking sites for the protein kinase ZAP70, leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Beyond its role in signal transduction, CD3Z is essential for intrathymic T-cell differentiation and contributes to the activity-dependent synapse formation of retinal ganglion cells (RGCs) in the retina and dorsal lateral geniculate nucleus (dLGN). The TCR-CD3 complex, comprising heterodimers CD3D/CD3E and CD3G/CD3E, associates preferentially with TCRalpha and TCRbeta, forming trimers. The hexamer interacts with CD3Z homodimers to complete the TCR-CD3 complex, demonstrating its versatility in TCR assembly. Additionally, CD3Z interacts with various proteins, such as SLA, TRAT1, DOCK2, SHB, ZAP70, and others, contributing to its multifaceted functions in immune responses and cellular interactions.

Verified Bioactivity

Measured by its ability to inhibit the cell growth of Jurkat cells. The ED50 for this effect is 198.5 ng/mL, corresponding to a specific activity is 5.038×103 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the cell growth of Jurkat cells. The ED50 for this effect is 198.5 ng/mL, corresponding to a specific activity is 5.038×103 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • CD3Z (R52-R164)
      Accession # P20963
    • C-term
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    CD247; T3Z; Prev. CD3Z; Tissue Factor-Targeting CAR1 Monomer; TCRZ; Tissue Factor-Targeting CAR1 Dimer; T-Cell Surface Glycoprotein CD3 Zeta Chain; CD247 Antigen, Isoform CRA_a; T-Cell Receptor T3 Zeta Chain; CD247 Antigen, Zeta Subunit; CD3-ZETA; CD247 T

  • AA Sequence

    RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

  • Predicted Molecular Mass

    13 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00