CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.
Background
CD30/TNFRSF8 protein, as a receptor for TNFSF8/CD30L, plays a key role in the regulation of cell growth and transformation of activated lymphoblasts. In addition, it may participate in the regulation of gene expression through the activation of NF-kappa-B signaling, thereby promoting a variety of cellular processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His;C-Avi
-
Accession
P28908 (F19-K379)
-
Molecular Construction
-
N-term
-
CD30 (F19-K379)
Accession # P28908 -
6*His-Avi
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
TNFRSF8; CD30L Receptor; Prev. D1S166E; Tumor Necrosis Factor Receptor Superfamily, Member 8; Prev. CD30; Cytokine Receptor CD30; KI-1; TNFRSF8 Protein; Tumor Necrosis Factor Receptor Superfamily Member 8; CD30 Antigen; Lymphocyte Activation Antigen CD30;
-
AA Sequence
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
-
Predicted Molecular Mass
41.1 kDa
-
Molecular Weight
Approximately 55-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)