CD30/TNFRSF8 Protein, Cynomolgus (HEK293, C-His)
Based on 1 Customer Validation
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Cynomolgus (HEK293, C-His) is the recombinant cynomolgus-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Cynomolgus (HEK293, C-His) is the recombinant cynomolgus-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD30/TNFRSF8 protein, as a receptor for TNFSF8/CD30L, plays a key role in the regulation of cell growth and transformation of activated lymphoblasts. In addition, it may participate in the regulation of gene expression through the activation of NF-kappa-B signaling, thereby promoting a variety of cellular processes.
Verified Bioactivity
Immobilized Cynomolgus CD30, His Tag at 0.5 μg/mL (100μl/Well) on the plate. Dose response curve for Anti-CD30 Antibody, hFc Tag with the EC50 of <7.2 ng/mL determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5VW07 (A27-P394)
-
Gene ID/
-
Molecular Construction
-
N-term
-
CD30 (A27-P394)
Accession # A0A2K5VW07 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TNFRSF8; CD30L Receptor; Prev. D1S166E; Tumor Necrosis Factor Receptor Superfamily, Member 8; Prev. CD30; Cytokine Receptor CD30; KI-1; TNFRSF8 Protein; Tumor Necrosis Factor Receptor Superfamily Member 8; CD30 Antigen; Lymphocyte Activation Antigen CD30;
-
AA Sequence
ADQDRPFEDTCRGNPGHYYDKAVRRCCYRCPTGLFPTQQCPQRPADCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKMPCAWNSSRVCECQPGMFCAVSVVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSNASTMPLRGGTRLAQEAASKLTRAPGSPSSVGRPSSDPGLSPTQPCPQGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRICECRPGMICATSATNSCARCVPYPICAAETGTKPQDMAEKDTTFEAPPVGTQPDCSPTPENGEAPASTSPTLSSLVDSQASKTLPIPTSAPIALSSTGKPVLDAGP
-
Predicted Molecular Mass
39.9 kDa
-
Molecular Weight
Approximately 75-105 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
