CLM9/CD300g Protein, Human (HEK293, His)

CLM9/CD300g Protein, Human (HEK293, His) is the recombinant human-derived CD300LG/Nepmucin protein, expressed by HEK293, with C-His tag.

CLM9/CD300g protein, known as a receptor, is thought to be involved in mediating lymphocyte rolling that is dependent on L-selectin. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), suggesting its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. The presence of CLM9/CD300g protein implies its significance in cellular adhesion and migration, particularly in the context of lymphocyte function. Further research is necessary to fully understand the precise mechanisms and functions of this protein, but its involvement in lymphocyte rolling and interaction underscores its potential importance in immune responses and lymphocyte-mediated processes.

Human

HEK293

C-8*His

AAH25395.1 (L19-R247)

Extracellular Domain

LEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLNSTSAEDTSPALSSGSSKPRVSIPMVR

Approximately 60-80 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.