CLM9/CD300g Protein, Human (HEK293, His)
CLM9/CD300g Protein, Human (HEK293, His) is the recombinant human-derived CD300LG/Nepmucin protein, expressed by HEK293, with C-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CLM9/CD300g Protein, Human (HEK293, His) is the recombinant human-derived CD300LG/Nepmucin protein, expressed by HEK293, with C-His tag.
Background
CLM9/CD300g protein, known as a receptor, is thought to be involved in mediating lymphocyte rolling that is dependent on L-selectin. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), suggesting its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. The presence of CLM9/CD300g protein implies its significance in cellular adhesion and migration, particularly in the context of lymphocyte function. Further research is necessary to fully understand the precise mechanisms and functions of this protein, but its involvement in lymphocyte rolling and interaction underscores its potential importance in immune responses and lymphocyte-mediated processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His
-
Accession
AAH25395.1 (L19-R247)
-
Gene ID146894
-
Protein Length
Extracellular Domain
-
Synonyms
CD300LG; Nepmucin; CD300 Molecule Like Family Member G; TREM-4; CLM9; CLM-9; Trem4; CD300 Molecule-Like Family Member G; Triggering Receptor Expressed On Myeloid Cells 4; CD300 Antigen Like Family Member G; CD300 Antigen-Like Family Member G; CD300g Antig
-
AA Sequence
LEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLNSTSAEDTSPALSSGSSKPRVSIPMVR
-
Predicted Molecular Mass
26.4 kDa
-
Molecular Weight
Approximately 28-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
