CD302/CLEC13A Protein, Mouse (HEK293, Fc)
CD302/CLEC13A Protein, a potential multifunctional C-type lectin receptor, may engage in endocytosis, phagocytosis, cell adhesion, and migration processes. CD302/CLEC13A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD302/CLEC13A protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD302/CLEC13A Protein, a potential multifunctional C-type lectin receptor, may engage in endocytosis, phagocytosis, cell adhesion, and migration processes. CD302/CLEC13A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD302/CLEC13A protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD302/CLEC13A protein is identified as a potential multifunctional C-type lectin receptor with putative involvement in diverse cellular processes. This protein is suggested to play roles in endocytosis and phagocytosis, highlighting its potential contribution to intracellular trafficking mechanisms. Additionally, CD302/CLEC13A is implicated in cell adhesion and migration, indicating its likely participation in cellular interactions and mobility. The multifaceted nature of CD302/CLEC13A suggests its versatility in various cellular functions, emphasizing its potential significance in immune responses and other biological processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9DCG2-2 (D21-H156)
-
Molecular Construction
-
N-term
-
CD302 (D21-H156)
Accession # Q9DCG2-2 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD302; Type I Transmembrane C-Type Lectin Receptor DCL-1; CD302 Molecule; C-Type Lectin Domain Family 13, Member A; CLEC13A; DEC205-Associated C-Type Lectin 1; CD302 Antigen; DCL1; KIAA0022; C-Type Lectin Domain Family 13 Member A; BIMLEC; C-Type Lectin B
-
AA Sequence
DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAANNH
-
Predicted Molecular Mass
42.6 kDa
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
