CD36 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
CD36 Protein, a member of the CD36 family, serves as a B-cell receptor recognizing TNFSF13B/TALL1/BAFF/BLyS. Crucial in supporting mature B-cell survival, CD36 enhances the B-cell response, contributing to maintaining a healthy immune system. CD36 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD36 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD36 Protein, a member of the CD36 family, serves as a B-cell receptor recognizing TNFSF13B/TALL1/BAFF/BLyS. Crucial in supporting mature B-cell survival, CD36 enhances the B-cell response, contributing to maintaining a healthy immune system. CD36 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD36 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD36 Protein belongs to the CD36 family. It is a B-cell receptor that specifically recognizes TNFSF13B/TALL1/BAFF/BLyS. CD36 plays a critical role in supporting the survival of mature B-cells and enhancing the B-cell response, thereby contributing to the maintenance of a healthy immune system.
Verified Bioactivity
Immobilized Cynomolgus CD36, His Tag at 0.5 μg/mL (100 μL/well) on the plate. Dose response curve for Anti-CD36 Antibody, hFc Tag with the EC50 of 0.5-5.0 ng/mL determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
Q4R6B4 (G30-N439)
-
Molecular Construction
-
N-term
-
CD36 (G30-N439)
Accession # Q4R6B4 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD36; Leukocyte Differentiation Antigen CD36; CD36 Molecule (CD36 Blood Group); Thrombospondin Receptor; Platelet Glycoprotein 4; CD36 Antigen; GPIIIB; PAS-4; GPIV; CD36 Molecule (CD36 Blood Group) Transcript; GP3B; Scavenger Receptor Class B, Member 3; F
-
AA Sequence
GDMLIQKTIKKEVVLEEGTIAFKNWVKTGTEIYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENITQDPKDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYPNPFVQVVLNSLINKSKSSMFQVRTLRELLWGYTDPFLSLVPYPVSTRVGMFYPYNNTADGVYKVFNGKDSISKVAIIDTYKGKRNLSYWESYCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVQNPDNHCFCTEKIISKNCTSYGVLDISKCKEGKPVYISLPHFLYASPDVSETIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSNKIQVLKRLKRNYIVPILWLNETGTIGDEKAKMFRSQVTGKIN
-
Predicted Molecular Mass
47.7 kDa
-
Molecular Weight
Approximately 65-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
