CD37 Protein, Human (HEK293, His)
CD37 protein is interact with SCIMP, suggesting a functional link between the two molecules. CD37 Protein, Human (HEK293, His) is the recombinant human-derived CD37 protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CD37 protein is interact with SCIMP, suggesting a functional link between the two molecules. CD37 Protein, Human (HEK293, His) is the recombinant human-derived CD37 protein, expressed by HEK293, with C-His labeled tag.
CD37 protein is known to interact with SCIMP, indicating a functional association between these two molecules. CD37 is a transmembrane protein that belongs to the tetraspanin family and is primarily expressed on the surface of B cells and other immune cells. It plays a role in various cellular processes, including signal transduction, adhesion, and immune modulation. The interaction with SCIMP suggests a potential involvement of CD37 in immune signaling pathways or protein complex formation, but further investigation is necessary to fully elucidate the functional significance of this interaction.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P11049-1 (A113-N240)
-
Gene ID951
-
Molecular Construction
-
N-term
-
CD37 (A113-N240)
Accession # P11049 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD37; Tspan-26; CD37 Molecule; CDNA FLJ25364 Fis, Clone TST01761, Highly Similar To LEUKOCYTE ANTIGEN CD37; TSPAN26; Cell Differentiation Antigen 37; Leukocyte Antigen CD37; Leukocyte Surface Antigen CD37; Tetraspanin-26; Tetraspanin; CD37 Antigen; GP52-4
-
AA Sequence
AQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN
-
Predicted Molecular Mass
15.7 kDa
-
Molecular Weight
Approximately 25-40 kDa,based on Bis-Tris PAGE under reducing conditions,due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
