CD3D-CD3E Heterodimer Protein, Cynomolgus (HEK293, His, flag)
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His;C-Flag
-
Accession
Q95LI8 (F22-A105) & Q95LI5 (Q22-D117)
-
Gene ID/&102133065
-
Molecular Construction
-
N-term
-
CD3D (F22-A105)
Accession # Q95LI8 -
flag
-
C-term
-
N-term
-
Q95LI5 CD3E (Q22-D117)
Accession # -
8*His
-
C-term
-
-
Synonyms
Mafa-AG; MHC class I antigen; CD3E; T3E; CD3 Epsilon Subunit Of T-Cell Receptor Complex; T-Cell Antigen Receptor Complex, Epsilon Subunit Of T3; T-Cell Surface Glycoprotein CD3 Epsilon Chain; CD3e Molecule; CD3-Epsilon; CD3e Antigen; CD3epsilon; CD3E Prot
-
AA Sequence
FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLA&QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD
-
Predicted Molecular Mass
15.5 kDa (CD3E) & 14.5 kDa (CD3D)
-
Molecular Weight
Approximately 15 kDa & 17 kDa & 27-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
