CD40 Protein, Canine (HEK293, Fc)

CD40 Protein, the receptor for TNFSF5/CD40LG, transduces signals via TRAF6 and MAP3K8, activating ERK in macrophages and B cells, leading to immunoglobulin secretion. Existing as a monomer and homodimer, CD40 interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6), with its interaction with TRAF6 and MAP3K8 crucial for ERK activation. CD40 Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD40 Protein, the receptor for TNFSF5/CD40LG, transduces signals via TRAF6 and MAP3K8, activating ERK in macrophages and B cells, leading to immunoglobulin secretion. Existing as a monomer and homodimer, CD40 interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6), with its interaction with TRAF6 and MAP3K8 crucial for ERK activation. CD40 Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD40 Protein acts as the receptor for TNFSF5/CD40LG, transducing signals mediated by TRAF6 and MAP3K8 to activate ERK in macrophages and B cells, ultimately inducing immunoglobulin secretion. Existing as both a monomer and homodimer, CD40 Protein interacts with various TRAF proteins, including TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6. Furthermore, its interaction with TRAF6 and MAP3K8 is essential for the activation of ERK.

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD40 (E21-A194)
      Accession # Q7YRL5
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily

  • AA Sequence

    EPRTACREKQYLVDSQCCNMCPPGEKLVNDCLHTIDTECTRCQTGEFLDTWNAERHCHQHKYCDPNLGLHVEKEGTSETDTTCTCDEGLHCTNAACESCTMHSLCPPGLGVKQIATGISDTICDPCPIGFFSNVSSALEKCHPWTSCETKGLVKVQAGTNKTDVICGPQPRLRA

  • Predicted Molecular Mass

    46.1 kDa

  • Molecular Weight

    Approximately 50-56 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00