CD40 Protein, Canine (HEK293, Fc)
CD40 Protein, the receptor for TNFSF5/CD40LG, transduces signals via TRAF6 and MAP3K8, activating ERK in macrophages and B cells, leading to immunoglobulin secretion. Existing as a monomer and homodimer, CD40 interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6), with its interaction with TRAF6 and MAP3K8 crucial for ERK activation. CD40 Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CD40 Protein, the receptor for TNFSF5/CD40LG, transduces signals via TRAF6 and MAP3K8, activating ERK in macrophages and B cells, leading to immunoglobulin secretion. Existing as a monomer and homodimer, CD40 interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6), with its interaction with TRAF6 and MAP3K8 crucial for ERK activation. CD40 Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD40 Protein acts as the receptor for TNFSF5/CD40LG, transducing signals mediated by TRAF6 and MAP3K8 to activate ERK in macrophages and B cells, ultimately inducing immunoglobulin secretion. Existing as both a monomer and homodimer, CD40 Protein interacts with various TRAF proteins, including TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6. Furthermore, its interaction with TRAF6 and MAP3K8 is essential for the activation of ERK.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-hFc
-
Accession
Q7YRL5 (E21-A194)
-
Molecular Construction
-
N-term
-
CD40 (E21-A194)
Accession # Q7YRL5 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily
-
AA Sequence
EPRTACREKQYLVDSQCCNMCPPGEKLVNDCLHTIDTECTRCQTGEFLDTWNAERHCHQHKYCDPNLGLHVEKEGTSETDTTCTCDEGLHCTNAACESCTMHSLCPPGLGVKQIATGISDTICDPCPIGFFSNVSSALEKCHPWTSCETKGLVKVQAGTNKTDVICGPQPRLRA
-
Predicted Molecular Mass
46.1 kDa
-
Molecular Weight
Approximately 50-56 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)