2. Recombinant Proteins
  3. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  4. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  5. TNF Superfamily Ligands CD40 Ligand/CD154
  6. CD40 Ligand
  7. CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His)

CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His)

Cat. No.: HY-P700554
Handling Instructions

CD40L/CD154/TRAP Protein, a cytokine, acts as a CD40/TNFRSF5 ligand, stimulating T-cell proliferation and cytokine production. It also facilitates immunoglobulin class switching and binds to integrins ITGA5:ITGB1 and ITGAV:ITGB3. CD40-CD40LG signaling requires both integrins and the CD40 receptor, leading to cell-type dependent effects like B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling. CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His) is the recombinant Rabbit-derived CD40L/CD154/TRAP protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His) is 149 a.a., with molecular weight of 18.2 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD40L/CD154/TRAP Protein, a cytokine, acts as a CD40/TNFRSF5 ligand, stimulating T-cell proliferation and cytokine production. It also facilitates immunoglobulin class switching and binds to integrins ITGA5:ITGB1 and ITGAV:ITGB3. CD40-CD40LG signaling requires both integrins and the CD40 receptor, leading to cell-type dependent effects like B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling. CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His) is the recombinant Rabbit-derived CD40L/CD154/TRAP protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His) is 149 a.a., with molecular weight of 18.2 kDa.
Background

CD40L/CD154/TRAP Protein is a cytokine that functions as a ligand to CD40/TNFRSF5. It plays a crucial role in costimulating T-cell proliferation and cytokine production. Additionally, it is involved in immunoglobulin class switching. CD40L/CD154/TRAP Protein acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3. Activation of CD40-CD40LG signaling requires both integrins and the CD40 receptor, and this signaling pathway has cell-type dependent effects, including B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling.
Species

Rabbit
Source

P. pastoris
Tag

N-6*His
Accession

G1SKP7 (M113-L261)
Gene ID

100358388  [NCBI]
Molecular Construction
N-term
6*His
CD40L (M113-L261)
Accession # G1SKP7
C-term
Synonyms
rHuCD40L; CD154; TRAP; TNFSF5; CD40LG; CD40-L
AA Sequence

MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL

Molecular Weight

18.2 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His)
Cat. No.:
HY-P700554
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.