CD42c/GP1BB Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD42c/GP1BB protein, present on platelets, interacts with von Willebrand factor to form platelet plugs. It forms a heterodimer with GP1B beta subunits and associates with GP-IX, facilitating platelet adhesion and initiating thrombus formation. CD42c also interacts with TRAF4, potentially regulating cellular signaling pathways. CD42c/GP1BB Protein, Human (HEK293, His) is the recombinant human-derived CD42c/GP1BB protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CD42c/GP1BB protein, present on platelets, interacts with von Willebrand factor to form platelet plugs. It forms a heterodimer with GP1B beta subunits and associates with GP-IX, facilitating platelet adhesion and initiating thrombus formation. CD42c also interacts with TRAF4, potentially regulating cellular signaling pathways. CD42c/GP1BB Protein, Human (HEK293, His) is the recombinant human-derived CD42c/GP1BB protein, expressed by HEK293 , with C-His labeled tag.
CD42c, also known as GP1BB, is a surface membrane protein on platelets crucial for the formation of platelet plugs through its interaction with von Willebrand factor, which is pre-bound to the subendothelium. The GP1BB protein forms a heterodimer with two disulfide-linked GP1B beta subunits and associates non-covalently with GP-IX. This intricate complex of GP1BB, GP1B alpha, and GP-IX plays a pivotal role in mediating platelet adhesion and initiating the process of thrombus formation. Additionally, CD42c has been identified to interact with TRAF4, suggesting potential regulatory roles in cellular signaling pathways.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P13224-1/NP_000398.1 (P27-C147)
-
Molecular Construction
-
N-term
-
GP1BB (P27-C147)
Accession # P13224-1/NP_000398.1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GP1BB; Truncated Platelet Membrane Glycoprotein Ib Beta; Glycoprotein Ib Platelet Subunit Beta; Platelet Membrane Glycoprotein Ib Beta; Platelet Glycoprotein Ib Beta Chain; Glycoprotein Ib Platelet Beta Subunit; Antigen CD42b-Beta; CD42c Antigen; GPIbbeta
-
AA Sequence
PAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
