CD43 Protein, Cynomolgus (HEK293, His)

CD43 protein is an important leukocyte surface sialic acid protein that plays a key role in T cell regulation. It has a positive impact on T cell function, including activation, proliferation, differentiation, trafficking and migration, especially by helping T cells migrate to lymph nodes through ERM proteins. CD43 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD43 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD43 protein is an important leukocyte surface sialic acid protein that plays a key role in T cell regulation. It has a positive impact on T cell function, including activation, proliferation, differentiation, trafficking and migration, especially by helping T cells migrate to lymph nodes through ERM proteins. CD43 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD43 protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD43 protein stands out as the predominant cell surface sialoprotein of leukocytes, orchestrating a myriad of crucial functions in T-cell regulation. It exerts a positive influence on T-cell activation, proliferation, differentiation, trafficking, and migration, notably facilitating T-cell trafficking to lymph nodes through its association with ERM proteins (EZR, RDX, and MSN). While playing a role in preparing T-cells for cytokine sensing and differentiation into effector cells, CD43 negatively regulates Th2 cell differentiation and steers T-cells toward a Th1 lineage commitment. Additionally, it plays a pivotal role in inducing the expression of IFN-gamma by T-cells during T-cell receptor (TCR) activation, promoting IFNGR and IL4R signaling, and mediating the clustering of IFNGR with TCR. Acting as a major E-selectin ligand, CD43 facilitates Th17 cell rolling on activated vasculature and recruitment during inflammation, mediating Th17 cell adhesion to E-selectin. Moreover, CD43 serves as a T-cell counter-receptor for SIGLEC1, contributing to cell survival by protecting cells from apoptotic signals.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD43 (D20-L253)
      Accession # XP_005591704.2
    • 8*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SPN; LSN; Sialophorin; Sialophorin (GpL115, Leukosialin, CD43); GPL115; Leukocyte Sialoglycoprotein; CD43; Galactoglycoprotein; Leukosialin; GALGP; LEU-22; CD43 Antigen

  • AA Sequence

    DTTAVQTPVPGETSGPLVSTSKYLSIDSEMYTTSITSDPKADGAGDQTSALPPSTSVNEGSPLGTSLGASTGSPLPEPTTLQNVSFEMSSMPQENPHATSHPAVPITANSLGFHTMTGGTMTTNSPETSSRTSGAPVTVAASSQETSKGTSGPPLTMATISLETSNGTSGPPVTIAAGSLETSTGTTGPPVTIAAGSLETSTGTTGPPVTMTTGSLEPSNVNTGPSVTMTTGSL

  • Predicted Molecular Mass

    24.1 kDa

  • Molecular Weight

    Approximately 90-120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00