Copy Link Print Information

CD46 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD46 protein is an important cofactor for complement factor I, a serine protease that protects autologous cells by cleaving deposited C3b and C4b. In addition to complement regulation, CD46 is involved in sperm-oocyte fusion during fertilization. CD46 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD46 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CD46 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD46 protein is an important cofactor for complement factor I, a serine protease that protects autologous cells by cleaving deposited C3b and C4b. In addition to complement regulation, CD46 is involved in sperm-oocyte fusion during fertilization. CD46 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD46 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD46 protein serves as a crucial cofactor for complement factor I, a serine protease responsible for safeguarding autologous cells against complement-mediated damage by cleaving deposited C3b and C4b on host tissue. Beyond its role in complement regulation, CD46 is implicated in the fusion process between spermatozoa and oocytes during fertilization. Additionally, CD46 acts as a costimulatory factor for T-cells, facilitating the differentiation of CD4+ cells into T-regulatory 1 cells. These specialized T-regulatory 1 cells contribute to immune modulation by secreting interleukin-10, thereby playing a pivotal role in suppressing immune responses and preventing autoimmunity.

Verified Bioactivity

Immobilized Cynomolgus CD46, His Tag at 5 μg/ml (100 μl/well) on the plate. Dose response curve for Anti-CD46 Antibody, hFc Tag with the EC50 of 0.72 μg/ml determined by ELISA.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession

    A0A2K5WCS2 (C35-D329)

  • Gene ID
    102146832
  • Molecular Construction
    • N-term
    • CD46 (C35-D329)
      Accession # A0A2K5WCS2
    • 8*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD46; CD46 Molecule, Complement Regulatory Protein; Prev. MIC10; Trophoblast Leukocyte Common Antigen; Prev. MCP; MGC26544; TLX; Complement System Membrane Cofactor Protein CD46; Membrane Cofactor Protein; Complement Membrane Cofactor Protein; TRA2.10; Tr

  • AA Sequence

    CEAPPTFEAMELIGKPKPYYRVGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDEGCYREMCPHIRDPLNGEAILANGSYEFGAELHFICNEGYYLIGKDILYCELKDTVAIWSGKPPLCEKILCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKVSTSPTTKSPTSSASGPRPTYKPPVSNYPGYPKPDEGILNNLDD

  • Predicted Molecular Mass

    34.1 kDa

  • Molecular Weight

    Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CD46 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • CD46 Protein, Cynomolgus (HEK293, His) Product Image