1. Recombinant Proteins
  2. CD Antigens Complement System
  3. Platelet CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Complement Regulatory Proteins
  4. Membrane Cofactor Protein/CD46
  5. CD46 Protein, Cynomolgus (HEK293, His)

CD46 protein is an important cofactor for complement factor I, a serine protease that protects autologous cells by cleaving deposited C3b and C4b. In addition to complement regulation, CD46 is involved in sperm-oocyte fusion during fertilization. CD46 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD46 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD46 protein is an important cofactor for complement factor I, a serine protease that protects autologous cells by cleaving deposited C3b and C4b. In addition to complement regulation, CD46 is involved in sperm-oocyte fusion during fertilization. CD46 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD46 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD46 protein serves as a crucial cofactor for complement factor I, a serine protease responsible for safeguarding autologous cells against complement-mediated damage by cleaving deposited C3b and C4b on host tissue. Beyond its role in complement regulation, CD46 is implicated in the fusion process between spermatozoa and oocytes during fertilization. Additionally, CD46 acts as a costimulatory factor for T-cells, facilitating the differentiation of CD4+ cells into T-regulatory 1 cells. These specialized T-regulatory 1 cells contribute to immune modulation by secreting interleukin-10, thereby playing a pivotal role in suppressing immune responses and preventing autoimmunity.

Biological Activity

Immobilized Cynomolgus CD46, His Tag at 5 μg/ml (100 μl/well) on the plate. Dose response curve for Anti-CD46 Antibody, hFc Tag with the EC50 of 0.72 μg/ml determined by ELISA.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5WCS2 (C35-D329)

Gene ID

102146832

Molecular Construction
N-term
CD46 (C35-D329)
Accession # A0A2K5WCS2
8*His
C-term
Protein Length

Partial

Synonyms
TLX; CD46; MCP; MIC10; AHUS2; TRA2.10
AA Sequence

CEAPPTFEAMELIGKPKPYYRVGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDEGCYREMCPHIRDPLNGEAILANGSYEFGAELHFICNEGYYLIGKDILYCELKDTVAIWSGKPPLCEKILCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKVSTSPTTKSPTSSASGPRPTYKPPVSNYPGYPKPDEGILNNLDD

Predicted Molecular Mass
34.1 kDa
Molecular Weight

Approximately 50-70 kDa,based on Bis-Tris PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD46 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD46 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700681
Quantity:
MCE Japan Authorized Agent: