CD46 Protein, Cynomolgus (HEK293, His)

CD46 protein is an important cofactor for complement factor I, a serine protease that protects autologous cells by cleaving deposited C3b and C4b. In addition to complement regulation, CD46 is involved in sperm-oocyte fusion during fertilization. CD46 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD46 protein, expressed by HEK293 , with C-His labeled tag.

CD46 protein serves as a crucial cofactor for complement factor I, a serine protease responsible for safeguarding autologous cells against complement-mediated damage by cleaving deposited C3b and C4b on host tissue. Beyond its role in complement regulation, CD46 is implicated in the fusion process between spermatozoa and oocytes during fertilization. Additionally, CD46 acts as a costimulatory factor for T-cells, facilitating the differentiation of CD4+ cells into T-regulatory 1 cells. These specialized T-regulatory 1 cells contribute to immune modulation by secreting interleukin-10, thereby playing a pivotal role in suppressing immune responses and preventing autoimmunity.

Immobilized Cynomolgus CD46, His Tag at 5 μg/ml (100 μl/well) on the plate. Dose response curve for Anti-CD46 Antibody, hFc Tag with the EC₅₀ of 0.72 μg/ml determined by ELISA.

Cynomolgus

HEK293

C-8*His

A0A2K5WCS2 (C35-D329)

102146832

Partial

CEAPPTFEAMELIGKPKPYYRVGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDEGCYREMCPHIRDPLNGEAILANGSYEFGAELHFICNEGYYLIGKDILYCELKDTVAIWSGKPPLCEKILCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKVSTSPTTKSPTSSASGPRPTYKPPVSNYPGYPKPDEGILNNLDD

Approximately 50-70 kDa,based on Bis-Tris PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<0.01 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.