CD47 Protein, Mouse (Biotinylated, HEK293, His-Avi)
Based on 1 publication(s) in Google Scholar
The CD47 protein is an adhesive multifunctional protein that coordinates cell-cell interactions, serves as a THBS1 receptor, and regulates integrin signaling through heterotrimeric G proteins. It plays a key role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cell self-renewal, immune regulation, and memory formation. CD47 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD47 protein is an adhesive multifunctional protein that coordinates cell-cell interactions, serves as a THBS1 receptor, and regulates integrin signaling through heterotrimeric G proteins. It plays a key role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cell self-renewal, immune regulation, and memory formation. CD47 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
CD47 Protein, an adhesive protein, orchestrates cell-to-cell interactions and acts as a receptor for thrombospondin THBS1, concurrently modulating integrin signaling through the activation of heterotrimeric G proteins. This multifaceted protein is intricately involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. CD47 plays a pivotal role in modulating pulmonary endothelin EDN1 signaling and acts as a pressor agent supporting blood pressure in response to THBS1-induced nitrous oxide (NO) signaling. Additionally, it contributes significantly to memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, CD47 prevents the maturation of immature dendritic cells, inhibits cytokine production by mature dendritic cells, and mediates cell-cell adhesion through interaction with SIRPG. Furthermore, it positively modulates FAS-dependent apoptosis in T-cells and suppresses angiogenesis, potentially influencing metabolic dysregulation during normal aging. CD47's role in wound healing modulation, inhibition of stem cell self-renewal, potential involvement in membrane transport, integrin-dependent signal transduction, and prevention of premature elimination of red blood cells underscores its diverse impact on cellular processes. Existing as a monomer, CD47 interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and possibly fibrinogen, emphasizing its intricate involvement in a wide array of cellular pathways.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Adv Res
Oral Delivery of siSIRPα via Yeast-Derived β-Glucan Particles Enhances Macrophage-Mediated Antitumor Immunity by Blocking the CD47-SIRPα Axis. [Abstract]2026 Mar 17:S2090-1232(26)00258-4. PMID: 41856472
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q61735-1 (Q19-K140)
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CD47; Antigen Identified By Monoclonal Antibody 1D8; Prev. MER6; Integrin-Associated Protein; Leukocyte Surface Antigen CD47; Rh-Related Antigen; IAP; CD47 Glycoprotein; Antigenic Surface Determinant Protein OA3; Integrin-Associated Signal Transducer; OA3
-
AA Sequence
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
-
Predicted Molecular Mass
17.4 kDa
-
Molecular Weight
Approximately 30-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)