CD59 Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, hFc) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, hFc) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) action. It functions by binding to the assembling MAC's C8 and/or C9 complements, thereby impeding the incorporation of multiple copies of C9 necessary for the formation of the osmolytic pore. Notably, this inhibitor exhibits species-specificity. Additionally, CD59 is involved in T-cell activation complexed with a protein tyrosine kinase for signal transduction. It is worth noting that while the soluble form of CD59 from urine retains its specific complement binding activity, it demonstrates a significantly reduced ability to inhibit MAC assembly on cell membranes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P13987-1 (L26-N102)
-
Molecular Construction
-
N-term
-
CD59 (L26-N102)
Accession # P13987-1 -
hFc
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CD59; CD59 Molecule, Complement Regulatory Protein; Prev. HRF20; CD59 Blood Group Antigen; Prev. MACIF; MAC-Inhibitory Protein; Prev. MIC11; MEM43 Antigen; Prev. MSK21; 1F5 Antigen; Prev. MIN1; HRF-20; Prev. MIN2; MAC-IP; Prev. MIN3; Surface Anitgen Recog
-
AA Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
-
Predicted Molecular Mass
35.7 kDa
-
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)