1. Recombinant Proteins
  2. CD Antigens
  3. Platelet CD Proteins Endothelial cell CD Proteins
  4. LAMP3/CD63
  5. CD63 Protein, Rat (HEK293, Fc)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD63 protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD63 protein, expressed by HEK293 , with N-mFc labeled tag.

Background

CD63 protein serves as a cell surface receptor for TIMP1, playing a crucial role in the activation of cellular signaling cascades. It contributes to the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. Its involvement promotes cell survival, actin cytoskeleton reorganization, cell adhesion, spreading, and migration by activating AKT and FAK/PTK2. CD63 is also implicated in VEGFA signaling through its regulation of KDR/VEGFR2 internalization. Additionally, it plays a role in intracellular vesicular transport processes and is essential for the normal trafficking of the PMEL luminal domain, crucial for melanocyte development and maturation. CD63 is further involved in leukocyte adhesion to endothelial cells by regulating SELP trafficking. While it may participate in mast cell degranulation in response to Ms4a2/FceRI stimulation, its role in degranulation in response to other stimuli remains limited. CD63 interacts with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1, forms a complex with CD9 and ITGB3, and interacts with PMEL, KDR/VEGFR2, and SYT7.

Species

Rat

Source

HEK293

Tag

N-mFc

Accession

P28648 (A103-V203)

Gene ID
Molecular Construction
N-term
mFc
CD63 (A103-V203)
Accession # P28648
C-term
Protein Length

Extracellular Domain

Synonyms
CD63 antigen; LAMP-3; Tspan-30; CD63; MLA1; TSPAN30
AA Sequence

AGYVFRDQVKSEFSKSFQKQMQNYLTDNKTATILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAAWLRKNV

Predicted Molecular Mass
38.1 kDa
Molecular Weight

Approximately 42-47 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD63 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD63 Protein, Rat (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD63 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74281
Quantity:
MCE Japan Authorized Agent: