CD63 Protein, Rat (HEK293, Fc)
The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD63 protein, expressed by HEK293 , with N-mFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD63 protein, expressed by HEK293 , with N-mFc labeled tag.
Background
CD63 protein serves as a cell surface receptor for TIMP1, playing a crucial role in the activation of cellular signaling cascades. It contributes to the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. Its involvement promotes cell survival, actin cytoskeleton reorganization, cell adhesion, spreading, and migration by activating AKT and FAK/PTK2. CD63 is also implicated in VEGFA signaling through its regulation of KDR/VEGFR2 internalization. Additionally, it plays a role in intracellular vesicular transport processes and is essential for the normal trafficking of the PMEL luminal domain, crucial for melanocyte development and maturation. CD63 is further involved in leukocyte adhesion to endothelial cells by regulating SELP trafficking. While it may participate in mast cell degranulation in response to Ms4a2/FceRI stimulation, its role in degranulation in response to other stimuli remains limited. CD63 interacts with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1, forms a complex with CD9 and ITGB3, and interacts with PMEL, KDR/VEGFR2, and SYT7.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag N-mFc
-
Accession
P28648 (A103-V203)
-
Molecular Construction
-
N-term
-
mFc
-
CD63 (A103-V203)
Accession # P28648 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD63; Tetraspanin-30; Prev. MLA1; AD1 Antigen; TSPAN30; Tspan-30; CD63 Antigen; OMA81H; Pltgp40; Limp1; HOP-26; Lysosomal-Associated Membrane Protein 3; ME491; Lysosome Integral Membrane Protein 1; AD1; Melanoma-Associated Antigen MLA1; Ocular Melanoma-As
-
AA Sequence
AGYVFRDQVKSEFSKSFQKQMQNYLTDNKTATILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAAWLRKNV
-
Predicted Molecular Mass
38.1 kDa
-
Molecular Weight
Approximately 42-47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
